Align UDP-glucose 4-epimerase (EC 5.1.3.7; EC 5.1.3.2) (characterized)
to candidate WP_085931120.1 AZO_RS17010 UDP-glucose 4-epimerase GalE
Query= metacyc::BSU38860-MONOMER (339 letters) >NCBI__GCF_000061505.1:WP_085931120.1 Length = 338 Score = 452 bits (1162), Expect = e-132 Identities = 220/337 (65%), Positives = 266/337 (78%), Gaps = 1/337 (0%) Query: 1 MAILVTGGAGYIGSHTCVELLNSGYEIVVLDNLSNSSAEALNRVKEITGKDLT-FYEADL 59 M +LVTGGAGYIGSHT +ELLN+G ++VV+DNLSN S EAL RV+ + G+ L F AD+ Sbjct: 2 MTVLVTGGAGYIGSHTVLELLNAGEQVVVIDNLSNGSEEALRRVEALAGRRLAGFVNADV 61 Query: 60 LDREAVDSVFAENEIEAVIHFAGLKAVGESVAIPLKYYHNNLTGTFILCEAMEKYGVKKI 119 D +A+D++FA + AVIHFA LKAVGESVA PL YY NN+ G L +AM + V+++ Sbjct: 62 RDVQALDALFARYTVSAVIHFAALKAVGESVAKPLAYYDNNVCGLLGLVDAMRRAEVRRL 121 Query: 120 VFSSSATVYGVPETSPITEDFPLGATNPYGQTKLMLEQILRDLHTADNEWSVALLRYFNP 179 VFSSSATVYG P + PI EDFP ATNPYG+TKLM EQIL D+ AD W +ALLRYFNP Sbjct: 122 VFSSSATVYGDPASVPIVEDFPTSATNPYGRTKLMCEQILADVAHADPAWRIALLRYFNP 181 Query: 180 FGAHPSGRIGEDPNGIPNNLMPYVAQVAVGKLEQLSVFGNDYPTKDGTGVRDYIHVVDLA 239 GAHPSGR+GEDP GIPNNLMPYV+QVAVG+L L VFG DYPT DGTGVRDYIHVVDLA Sbjct: 182 VGAHPSGRLGEDPAGIPNNLMPYVSQVAVGRLPALQVFGGDYPTPDGTGVRDYIHVVDLA 241 Query: 240 EGHVKALEKVLNSTGADAYNLGTGTGYSVLEMVKAFEKVSGKEVPYRFADRRPGDIATCF 299 GH+ AL ++ + DA NLGTG GYSVLE+V+AF K SG+ VP+R DRRPGD+A C+ Sbjct: 242 LGHLSALRRLDSLPPVDAINLGTGCGYSVLEVVEAFRKASGRAVPFRIVDRRPGDVAACW 301 Query: 300 ADPAKAKRELGWEAKRGLEEMCADSWRWQSSNVNGYK 336 AD AKA+R LGW+A+RG+ EMCAD+WRWQS+N +GY+ Sbjct: 302 ADTAKARRVLGWQAERGIAEMCADAWRWQSANPSGYR 338 Lambda K H 0.315 0.134 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 427 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 338 Length adjustment: 28 Effective length of query: 311 Effective length of database: 310 Effective search space: 96410 Effective search space used: 96410 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_085931120.1 AZO_RS17010 (UDP-glucose 4-epimerase GalE)
to HMM TIGR01179 (galE: UDP-glucose 4-epimerase GalE (EC 5.1.3.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01179.hmm # target sequence database: /tmp/gapView.5599.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01179 [M=332] Accession: TIGR01179 Description: galE: UDP-glucose 4-epimerase GalE Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-139 450.7 0.0 1.4e-139 450.5 0.0 1.0 1 lcl|NCBI__GCF_000061505.1:WP_085931120.1 AZO_RS17010 UDP-glucose 4-epimer Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000061505.1:WP_085931120.1 AZO_RS17010 UDP-glucose 4-epimerase GalE # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 450.5 0.0 1.4e-139 1.4e-139 2 331 .. 4 336 .. 3 337 .. 0.99 Alignments for each domain: == domain 1 score: 450.5 bits; conditional E-value: 1.4e-139 TIGR01179 2 iLvtGgaGyiGshvvrqllekgkevvvlDnlskgskealkalekit...evklvegdladkekleavle 67 +LvtGgaGyiGsh+v +ll++g +vvv+Dnls+gs+eal+++e + +v++d++d ++l+a+++ lcl|NCBI__GCF_000061505.1:WP_085931120.1 4 VLVTGGAGYIGSHTVLELLNAGEQVVVIDNLSNGSEEALRRVEALAgrrLAGFVNADVRDVQALDALFA 72 8******************************************998875678***************** PP TIGR01179 68 eekidaviHfaaliavgEsvkePlkYYennvvntleLleamqkagvkkliFsssaavYgesekvpisEe 136 + ++ aviHfaal+avgEsv++Pl YY+nnv + l L++am++a+v++l+Fsssa+vYg++ +vpi E+ lcl|NCBI__GCF_000061505.1:WP_085931120.1 73 RYTVSAVIHFAALKAVGESVAKPLAYYDNNVCGLLGLVDAMRRAEVRRLVFSSSATVYGDPASVPIVED 141 ********************************************************************* PP TIGR01179 137 splnpinpYGrsklmvErilkdlkkadkelkvviLRYFnvaGAdeegeiGeasknat.hliklvaevav 204 +p++++npYGr+klm E+il d+++ad+++++++LRYFn++GA+++g++Ge++ +++ +l+++v +vav lcl|NCBI__GCF_000061505.1:WP_085931120.1 142 FPTSATNPYGRTKLMCEQILADVAHADPAWRIALLRYFNPVGAHPSGRLGEDPAGIPnNLMPYVSQVAV 210 *********************************************************9*********** PP TIGR01179 205 gkrekleifGtdyptkDGtcvRDyiHveDlaeaHlaalealeeggesevynlGagqgfsvkevieavkk 273 g++++l++fG+dypt+DGt+vRDyiHv Dla +Hl al+ l + +++ nlG+g g+sv+ev+ea++k lcl|NCBI__GCF_000061505.1:WP_085931120.1 211 GRLPALQVFGGDYPTPDGTGVRDYIHVVDLALGHLSALRRLDSLPPVDAINLGTGCGYSVLEVVEAFRK 279 ********************************************************************* PP TIGR01179 274 vsgkdikveladrRaGDpaslvadaskikrelgwkpkyddLeeiiksawdWekklkeg 331 +sg+ +++++ drR+GD+a+++ad++k++r+lgw+++++ ++e++++aw+W++ +++g lcl|NCBI__GCF_000061505.1:WP_085931120.1 280 ASGRAVPFRIVDRRPGDVAACWADTAKARRVLGWQAERG-IAEMCADAWRWQSANPSG 336 ***************************************.*************99876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (332 nodes) Target sequences: 1 (338 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 8.90 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory