Align Inner-membrane translocator (characterized, see rationale)
to candidate WP_085979178.1 SACCYDRAFT_RS14750 sugar ABC transporter permease YjfF
Query= uniprot:A0KWY6 (405 letters) >NCBI__GCF_000244975.1:WP_085979178.1 Length = 310 Score = 123 bits (309), Expect = 6e-33 Identities = 91/306 (29%), Positives = 160/306 (52%), Gaps = 30/306 (9%) Query: 73 LLANLFIDSSFFNISYQDDRLYGSLIDILNRSAPVALLSIGMSLVIATGGIDLSVGAVMA 132 ++ANLF+D++F + +L++GM+ VI TGGIDLSVG+V+A Sbjct: 29 VVANLFVDNAF-----------------------LIVLAVGMTFVILTGGIDLSVGSVVA 65 Query: 133 IAGAVCANLLLVPDISLVTVIAAGLIVGLLAGCINGGLVSFLGIQPIVATLLLMVAGRGV 192 ++ V A+ L VI A L++G G + G ++ +QP +ATL M RG+ Sbjct: 66 LSTMVAASTLQA-GWPAPLVIVAVLVLGAGFGLLTGLVIHHFDVQPFIATLAGMFLARGL 124 Query: 193 AQLINQGQII----TFQHPGFAAIGVGQFLGLPMPVWIVIGMLTFSQLLLRKTALGLFIE 248 LI+ I TF+ I + + + V + + ++ + +L +T G + Sbjct: 125 CFLIDVESISIKDDTFRDLATGVIELPGDIRITYGVVVALLVVAVAVYVLHRTRFGRTVY 184 Query: 249 AVGCNAKASRYLGINDKSIKLFAYGIAGLCAALAGMISTADIQGSDANNAGLWLELDAVL 308 AVG + ++ +G+ +K+ Y I+GLC+AL G++ + +A + +ELDA+ Sbjct: 185 AVGGSEHSAMLMGLATGRVKVGVYVISGLCSALGGLLFALYMLSGYGLHA-VGMELDAIA 243 Query: 309 AVVIGGAALTGGRFSLILSVVGALIIQTLATTIIVSG-LPAKFNLLIKAIVILTVLLLQS 367 AVVIGG L+GG ++ SV+G L++ T+ T I G L + + ++ ++L +++Q Sbjct: 244 AVVIGGTVLSGGAGYVVGSVLGVLMLGTIQTIISFEGTLSSWWTKIVVGALLLVFIVMQR 303 Query: 368 AKFRRQ 373 A RR+ Sbjct: 304 AIVRRR 309 Lambda K H 0.323 0.136 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 302 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 405 Length of database: 310 Length adjustment: 29 Effective length of query: 376 Effective length of database: 281 Effective search space: 105656 Effective search space used: 105656 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory