GapMind for catabolism of small carbon sources

 

Protein WP_085979178.1 in Saccharomonospora cyanea NA-134

Annotation: NCBI__GCF_000244975.1:WP_085979178.1

Length: 310 amino acids

Source: GCF_000244975.1 in NCBI

Candidate for 25 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-arabinose catabolism araZsh hi Inner-membrane translocator (characterized, see rationale) 50% 97% 307.8 Inner membrane ABC transporter permease protein YjfF 46% 274.6
D-galactose catabolism yjtF hi Inner membrane ABC transporter permease protein YjfF (characterized) 46% 93% 274.6 Fructose import permease protein FruG 43% 248.1
D-fructose catabolism fruG med Fructose import permease protein FruG (characterized) 43% 91% 248.1 Inner membrane ABC transporter permease protein YjfF 46% 274.6
sucrose catabolism fruG med Fructose import permease protein FruG (characterized) 43% 91% 248.1 Inner membrane ABC transporter permease protein YjfF 46% 274.6
xylitol catabolism PS417_12060 lo ABC transporter permease; SubName: Full=Monosaccharide ABC transporter membrane protein, CUT2 family; SubName: Full=Sugar ABC transporter permease (characterized, see rationale) 40% 78% 173.7 Inner membrane ABC transporter permease protein YjfF 46% 274.6
D-ribose catabolism rbsC lo ABC-type transporter, integral membrane subunit, component of D-ribose porter (Nanavati et al., 2006). Induced by ribose (characterized) 35% 90% 170.6 Inner membrane ABC transporter permease protein YjfF 46% 274.6
D-mannose catabolism HSERO_RS03645 lo ABC-type sugar transport system, permease component protein (characterized, see rationale) 35% 87% 169.5 Inner membrane ABC transporter permease protein YjfF 46% 274.6
D-fructose catabolism frcC lo Ribose ABC transport system, permease protein RbsC (characterized, see rationale) 34% 88% 162.5 Inner membrane ABC transporter permease protein YjfF 46% 274.6
sucrose catabolism frcC lo Ribose ABC transport system, permease protein RbsC (characterized, see rationale) 34% 88% 162.5 Inner membrane ABC transporter permease protein YjfF 46% 274.6
D-cellobiose catabolism mglC lo MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter (characterized) 33% 90% 158.7 Inner membrane ABC transporter permease protein YjfF 46% 274.6
D-galactose catabolism mglC lo MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter (characterized) 33% 90% 158.7 Inner membrane ABC transporter permease protein YjfF 46% 274.6
D-glucose catabolism mglC lo MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter (characterized) 33% 90% 158.7 Inner membrane ABC transporter permease protein YjfF 46% 274.6
lactose catabolism mglC lo MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter (characterized) 33% 90% 158.7 Inner membrane ABC transporter permease protein YjfF 46% 274.6
D-maltose catabolism mglC lo MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter (characterized) 33% 90% 158.7 Inner membrane ABC transporter permease protein YjfF 46% 274.6
sucrose catabolism mglC lo MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter (characterized) 33% 90% 158.7 Inner membrane ABC transporter permease protein YjfF 46% 274.6
trehalose catabolism mglC lo MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter (characterized) 33% 90% 158.7 Inner membrane ABC transporter permease protein YjfF 46% 274.6
L-fucose catabolism HSERO_RS05255 lo ABC-type sugar transport system, permease component protein (characterized, see rationale) 37% 78% 157.1 Inner membrane ABC transporter permease protein YjfF 46% 274.6
L-arabinose catabolism araH lo L-arabinose ABC transporter, permease protein AraH (characterized) 34% 89% 150.6 Inner membrane ABC transporter permease protein YjfF 46% 274.6
D-mannose catabolism frcC lo Fructose import permease protein FrcC (characterized) 32% 84% 144.4 Inner membrane ABC transporter permease protein YjfF 46% 274.6
D-ribose catabolism frcC lo Fructose import permease protein FrcC (characterized) 32% 84% 144.4 Inner membrane ABC transporter permease protein YjfF 46% 274.6
2'-deoxyinosine catabolism H281DRAFT_01112 lo deoxynucleoside transporter, permease component 2 (characterized) 31% 86% 132.1 Inner membrane ABC transporter permease protein YjfF 46% 274.6
L-arabinose catabolism araWsh lo Inner-membrane translocator (characterized, see rationale) 31% 76% 129 Inner membrane ABC transporter permease protein YjfF 46% 274.6
D-galactose catabolism ytfT lo Galactofuranose transporter permease protein YtfT (characterized) 31% 89% 128.6 Inner membrane ABC transporter permease protein YjfF 46% 274.6
D-fructose catabolism fruF lo Fructose import permease protein FruF (characterized) 31% 81% 125.6 Inner membrane ABC transporter permease protein YjfF 46% 274.6
sucrose catabolism fruF lo Fructose import permease protein FruF (characterized) 31% 81% 125.6 Inner membrane ABC transporter permease protein YjfF 46% 274.6

Sequence Analysis Tools

View WP_085979178.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MPILTTFALFLATFGVGAVRYDGFASGQVVANLFVDNAFLIVLAVGMTFVILTGGIDLSV
GSVVALSTMVAASTLQAGWPAPLVIVAVLVLGAGFGLLTGLVIHHFDVQPFIATLAGMFL
ARGLCFLIDVESISIKDDTFRDLATGVIELPGDIRITYGVVVALLVVAVAVYVLHRTRFG
RTVYAVGGSEHSAMLMGLATGRVKVGVYVISGLCSALGGLLFALYMLSGYGLHAVGMELD
AIAAVVIGGTVLSGGAGYVVGSVLGVLMLGTIQTIISFEGTLSSWWTKIVVGALLLVFIV
MQRAIVRRRS

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory