Align High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_085984847.1 MA_RS14050 DUF4162 domain-containing protein
Query= TCDB::P21630 (233 letters) >NCBI__GCF_000007345.1:WP_085984847.1 Length = 328 Score = 111 bits (277), Expect = 2e-29 Identities = 66/215 (30%), Positives = 125/215 (58%), Gaps = 5/215 (2%) Query: 1 MLSFDKVSTYYGKIQALHDVSVEVKKGEIVTLIGANGAGKSTLLMTLCGSPQAASGSIRY 60 ++ + + ++G+++A+ +S VK+GEI + +G NGAGKST++ L G R Sbjct: 5 IIEVNDLEYFFGEVKAVDKISFTVKEGEIFSFLGPNGAGKSTVINVLTTLLPVQKGRARV 64 Query: 61 EGEELVGLPSSTIMRKSIAVVPEGRRVFSRLTVEENLAMGG--FFTDKDDYQVQMDKVLE 118 G +L P +R+SI +V + + +TV E L G + K Q +++++++ Sbjct: 65 AGFDLKTEPEK--VRESIGIVFQELTLDRDMTVREILEYHGRLYSMPKVARQERIEELIK 122 Query: 119 LFPRLKERYEQRAGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQIFEIIEQ 178 L L+ + + SGG ++ L I R LM++PK+L +DEP++GL P +I+E ++ Sbjct: 123 LV-ELEGKRDTLTRHFSGGMKRRLEIARGLMTRPKVLFMDEPTIGLDPQTRIRIWEYVKD 181 Query: 179 LRREGVTVFLVEQNANQALKLADRAYVLENGRIVM 213 + REG T+FL ++A +L+DR ++++G+I++ Sbjct: 182 INREGTTIFLTTHYMDEADQLSDRISIIDHGKIIV 216 Lambda K H 0.318 0.136 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 193 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 233 Length of database: 328 Length adjustment: 25 Effective length of query: 208 Effective length of database: 303 Effective search space: 63024 Effective search space used: 63024 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory