Align TM0028, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)
to candidate WP_086508118.1 BZY95_RS00870 ABC transporter ATP-binding protein
Query= TCDB::Q9WXN5 (330 letters) >NCBI__GCF_002151265.1:WP_086508118.1 Length = 766 Score = 238 bits (607), Expect = 4e-67 Identities = 134/320 (41%), Positives = 198/320 (61%), Gaps = 11/320 (3%) Query: 5 LLKAENVRAYYKLEKVSVKAVDGLSFEILEDEVIGVVGESGCGKTTLSNVIFMNMVKPLT 64 LLK E++ +Y+ V+AVDG+ F++ E +G+VGESGCGKTT + + + ++ P Sbjct: 6 LLKVEDLAIHYRTGAGPVQAVDGIHFDLRPGEALGLVGESGCGKTTAAKAM-LRLLPP-- 62 Query: 65 LVDGKIFL-RVNGEFVELSSMTRDEVKRKFWGKEITIIPQAAMNALMPTIRMEKYVRHLA 123 +G++ R++ + +L ++ + +++ W KEI I QAAMNAL P + + Sbjct: 63 --NGEVPRGRIDFDGRDLVALDEESMRKVRW-KEIAWISQAAMNALDPVYTVGDQILEAM 119 Query: 124 ESH-GIDEEELLDKARRRFEEVGLDPLWIKRYPFELSGGMRQRAVIAIATILNPSLLIAD 182 +H ID + A F VG+DP + YP E+SGGM+QRAVIA+A L+P L+IAD Sbjct: 120 NAHIKIDRKTAWAHAEELFRAVGIDPGRLSAYPHEMSGGMKQRAVIAMALALDPKLIIAD 179 Query: 183 EPTSALDVVNQKVLLKVLMQMKRQGIVKSIIFITHDIATVRQIADRMIIMYAGKIVEFAP 242 EPT+ALDVV Q +L L +++R+ + ++FITHDI+ V Q DR+ +MY G I+E P Sbjct: 180 EPTTALDVVTQAQILARLSKLRRERGM-GLLFITHDISVVVQTCDRVAVMYGGHIMETGP 238 Query: 243 VESLLEKPLHPYTQGLFNSVLTPEPEVKKRGITTIPGAPPNLINPPSGCRFHPRCPHAMD 302 V + P HPYT GL N+ P E +R + +IPG+PP+L+NPPSGCRF RCP A + Sbjct: 239 VREVFGTPFHPYTMGLTNAF--PTLEGAQRELISIPGSPPDLLNPPSGCRFAERCPFATE 296 Query: 303 VCKEKEPPLTEIEPGRRVAC 322 C + PPL + R+ AC Sbjct: 297 RCVRETPPLHPVGEERQAAC 316 Score = 175 bits (443), Expect = 4e-48 Identities = 112/316 (35%), Positives = 170/316 (53%), Gaps = 27/316 (8%) Query: 4 ILLKAENVRAYYKLEKV------------SVKAVDGLSFEILEDEVIGVVGESGCGKTTL 51 +LL+ E ++ ++ +E+ V AVDG+SF++ E E++G+ GESG GKTT Sbjct: 361 LLLEVEELKKHFPVEQGFLDGLRGRNKDRKVHAVDGISFDLREGEILGLAGESGSGKTTT 420 Query: 52 SNVIFMNMVKPLTLVDGKIFLRVNGEFVELSSMTRDEVKRKFWGKEITIIPQAAMNALMP 111 ++ V+ L + +G+I E +++ +T E+K + + +I Q L P Sbjct: 421 GEML----VRLLDVTEGEIRF----EGADIAQLTGRELKT--FRRRAQMIFQDPYQTLNP 470 Query: 112 TIRMEKYVRHLAESHGIDEEELL-DKARRRFEEVGLDP--LWIKRYPFELSGGMRQRAVI 168 + V H + E E L K E GL P ++ +R+P ELSGG RQR I Sbjct: 471 RFTIFDIVAEPLIIHRLAEGEALRQKVVVALERAGLKPAEVYAERFPHELSGGQRQRVAI 530 Query: 169 AIATILNPSLLIADEPTSALDVVNQKVLLKVLMQMKRQGIVKSIIFITHDIATVRQIADR 228 A A +L P ++ADEP S LDV + +L LM R + S ++++HD+ T+R +ADR Sbjct: 531 ARAIVLEPRFIVADEPVSMLDVSIRAGVLN-LMHRFRNELGISFVYVSHDLPTIRYVADR 589 Query: 229 MIIMYAGKIVEFAPVESLLEKPLHPYTQGLFNSVLTPEPEVKKRGITTIPGAPPNLINPP 288 IMY G+IVE P E ++ + HPYTQ L + P+P V K + + G P+ + PP Sbjct: 590 TAIMYLGEIVEVGPTEQVVRERKHPYTQLLLEASPEPDPAVVKPPLES-AGEIPSAVEPP 648 Query: 289 SGCRFHPRCPHAMDVC 304 +GC FH RCP AM C Sbjct: 649 NGCHFHTRCPRAMAHC 664 Lambda K H 0.321 0.138 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 663 Number of extensions: 38 Number of successful extensions: 9 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 330 Length of database: 766 Length adjustment: 34 Effective length of query: 296 Effective length of database: 732 Effective search space: 216672 Effective search space used: 216672 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory