Align Binding-protein-dependent transport systems inner membrane component (characterized, see rationale)
to candidate WP_086508159.1 BZY95_RS01105 maltose ABC transporter permease MalG
Query= uniprot:C8WUQ9 (301 letters) >NCBI__GCF_002151265.1:WP_086508159.1 Length = 296 Score = 167 bits (424), Expect = 2e-46 Identities = 95/277 (34%), Positives = 151/277 (54%), Gaps = 25/277 (9%) Query: 46 IVMVLLPMWFVVIASFNPSNSYISFSLFPSNASLANYKALFQGGQFWT------------ 93 + ++L P+ V+ SF N + + SL P SL ++ G W Sbjct: 24 LTLILFPLLLVISISFREGN-FATGSLIPERFSLEHWSLAL--GIPWERADGTVVQPPFP 80 Query: 94 ---WVRNSLVVGVVVAMAQSFITAMSAFAFSKLRFYGRKYGLMTLLLLQMFPNILAIAAF 150 W+ NS+ V +V ++ ++ SA+AF+++RF G+ L ++L+ QMFP +L++ A Sbjct: 81 VLLWLWNSVKVAIVSSLLIVLLSTTSAYAFARMRFAGKGPILKSMLIFQMFPAVLSLVAL 140 Query: 151 YTALAKLNM------IDMLGSYILVMLGTSAFNIWLLKGYMDSVPKELDEAAVIDGATTW 204 Y +L I+ G+ I+ LG A +IW +KGY +S+ L+EAA++DGA+TW Sbjct: 141 YALFDRLGQFVGWLGINTHGALIVASLGAVALHIWTIKGYFESIDGSLEEAAMVDGASTW 200 Query: 205 QRFIHVTLPLSTPMMVVIFFLTLVGIFSEYMFAGTILQSPWNYTLGVGMYNLISGQFAKN 264 Q F ++ LPLS P+++V+F L V EY A +L TL VG ++ + Sbjct: 201 QAFRYILLPLSLPILMVVFILAFVMSIMEYPMASVLLVDEHKLTLAVGAQQYLA-DHNQR 259 Query: 265 WGEFAAAALLSAVPLAIVFAVAQRYLTKGLVAGSVKG 301 WG FAAAA+LS +P+ + F + QR++ GL AG VKG Sbjct: 260 WGNFAAAAVLSGLPITLAFLICQRWIIGGLTAGGVKG 296 Lambda K H 0.328 0.136 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 249 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 296 Length adjustment: 27 Effective length of query: 274 Effective length of database: 269 Effective search space: 73706 Effective search space used: 73706 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory