Align MalG, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized)
to candidate WP_086508159.1 BZY95_RS01105 maltose ABC transporter permease MalG
Query= TCDB::Q8DT26 (278 letters) >NCBI__GCF_002151265.1:WP_086508159.1 Length = 296 Score = 135 bits (339), Expect = 1e-36 Identities = 93/297 (31%), Positives = 155/297 (52%), Gaps = 23/297 (7%) Query: 1 MKRKKQLQIGSIYALLILLSFIWL--FPIIWVILTSFRGEGTAYVPYIIPKTWTLDNYIK 58 M + + L+ + A L L+ F+ L FP++ VI SFR EG +IP+ ++L+++ Sbjct: 3 MVQPRSLRWRKLAAHLALIGFLTLILFPLLLVISISFR-EGNFATGSLIPERFSLEHWSL 61 Query: 59 LF-----------TNSSFPFGRWFLNTLIVSTATCVLSTSITVAMAYSLSRIKFKHRNGF 107 FP W N++ V+ + +L ++ AY+ +R++F + Sbjct: 62 ALGIPWERADGTVVQPPFPVLLWLWNSVKVAIVSSLLIVLLSTTSAYAFARMRFAGKGPI 121 Query: 108 LKLALVLNMFPGFMSMIAVYYILKALNL------TQTLTSLVLVYSSGAALTFYIAKGFF 161 LK L+ MFP +S++A+Y + L T +L++ AL + KG+F Sbjct: 122 LKSMLIFQMFPAVLSLVALYALFDRLGQFVGWLGINTHGALIVASLGAVALHIWTIKGYF 181 Query: 162 DTIPYSLDESAMIDGATRKDIFLKITLPLSKPIIVYTALLAFIAPWIDFIFAQVILGDAT 221 ++I SL+E+AM+DGA+ F I LPLS PI++ +LAF+ +++ A V+L D Sbjct: 182 ESIDGSLEEAAMVDGASTWQAFRYILLPLSLPILMVVFILAFVMSIMEYPMASVLLVD-E 240 Query: 222 SKYTVAIGLFSMLQADTINNWFMAFAAGSVLIAIPITILFIFMQKYYVEGITGGSVK 278 K T+A+G L AD W FAA +VL +PIT+ F+ Q++ + G+T G VK Sbjct: 241 HKLTLAVGAQQYL-ADHNQRW-GNFAAAAVLSGLPITLAFLICQRWIIGGLTAGGVK 295 Lambda K H 0.330 0.142 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 238 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 296 Length adjustment: 26 Effective length of query: 252 Effective length of database: 270 Effective search space: 68040 Effective search space used: 68040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory