Align ABC transporter for L-Fucose, ATPase component (characterized)
to candidate WP_086508166.1 BZY95_RS01120 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::Smeli:SM_b21106 (365 letters) >NCBI__GCF_002151265.1:WP_086508166.1 Length = 371 Score = 310 bits (795), Expect = 3e-89 Identities = 182/365 (49%), Positives = 230/365 (63%), Gaps = 22/365 (6%) Query: 1 MAPVTLKKLVKRYGALEVVHGIDLEVKDREFIALVGPSGCGKSTTLRMIAGLEEVSGGAI 60 M +TL + K Y +EV IDL ++D EF+ VGPSGCGKST LRMIAGLE++S G + Sbjct: 1 MGRLTLAGIGKDYAGVEVSRDIDLTIEDGEFVVFVGPSGCGKSTLLRMIAGLEDISHGEM 60 Query: 61 EIGGRKVNDLPPRARNISMVFQSYALYPHMTVAENMGFSLKIAGRPAEEIKTRVAEAAAI 120 + G ++N++PP+ R+I MVFQSYALYPHMTVAENM F LK+A EI+ RV AA + Sbjct: 61 RLDGERINEVPPQERDIGMVFQSYALYPHMTVAENMAFGLKLARTDKAEIRRRVEHAAEM 120 Query: 121 LDLAHLLERRPSQLSGGQRQRVAMGRAIVRQPDVFLFDEPLSNLDAKLRTQVRTEIKKLH 180 L L LLER+P +LSGGQRQRVA+GR +V++P VFLFDEPLSNLDA LR +R +I +LH Sbjct: 121 LHLGELLERKPKELSGGQRQRVAIGRTLVKEPAVFLFDEPLSNLDAALRVDMRVQIAELH 180 Query: 181 ARMQATMIYVTHDQVEAMTLSDRIVIMRDGHIEQVGTPEDVFRRPATKFVAGFIGSPPMN 240 R+ ATMIYVTHDQVEAMTL+DRIV++ G I QVG P ++ PAT VA FIGSP +N Sbjct: 181 RRLGATMIYVTHDQVEAMTLADRIVLLAGGRIAQVGAPLSLYHFPATLEVARFIGSPRIN 240 Query: 241 -MEEAVLTDGK----LAFASGATLPLPPRFRSLVREGQKVTFGLRPDDVYPSGHGLHAGD 295 + VL G+ + GATL + L R G K T +R +D + D Sbjct: 241 VIPVEVLDPGRQRTSVRLPDGATLAVAVDGARL-RAGDKATLAVRAEDF------VTPAD 293 Query: 296 ADAVHEIELPVTITEPLGNETLVFTQFNGRDWVSRMLNPR-----PLRPGEAVPMSFDLA 350 ADA + + + E LG ETL + G VS L R L G+AV + Sbjct: 294 ADA--RLTARLMVAERLGYETLAHLRVEG---VSETLTQRLDGLTRLEDGQAVELGLSGE 348 Query: 351 RAHLF 355 R HLF Sbjct: 349 RCHLF 353 Lambda K H 0.320 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 375 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 371 Length adjustment: 30 Effective length of query: 335 Effective length of database: 341 Effective search space: 114235 Effective search space used: 114235 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory