Align 3-isopropylmalate dehydratase subunit LeuD (EC 4.2.1.33) (characterized)
to candidate WP_086508302.1 BZY95_RS01835 3-isopropylmalate dehydratase small subunit
Query= ecocyc::LEUD-MONOMER (201 letters) >NCBI__GCF_002151265.1:WP_086508302.1 Length = 210 Score = 147 bits (372), Expect = 1e-40 Identities = 84/182 (46%), Positives = 111/182 (60%), Gaps = 3/182 (1%) Query: 14 PLDAANVDTDAIIPKQFLQKVTRTGFGAHLFNDWRFLDEKGQQPNPDFVLNFPQYQGASI 73 PL ANVDTD +IP +F+++ G+G L +D R DE G+ P F+LN PQ A Sbjct: 13 PLPLANVDTDQLIPARFMKEPRSVGYGRFLLHDLRH-DENGR-PVVGFILNHPQADEAKT 70 Query: 74 LLARENFGCGSSREHAPWALTDYGFKVVIAPSFADIFYGNSFNNQLLPVKLSDAEVDELF 133 L+AR NFG GSSRE A +AL D+GF+ VIAPSF DIF N+ NN LLP +S+A+ + L Sbjct: 71 LVARRNFGAGSSREAAVYALVDFGFRCVIAPSFGDIFASNAVNNGLLPATVSEADAEALL 130 Query: 134 ALVKANPGIHFDVDLEAQEVKAGEKTYRFTIDAFRRHCMMNGLDSIGLTLQHDDAIAAYE 193 A + +P VDLEAQ + GE + FTI R ++NG D I +T QH IA + Sbjct: 131 AALGESPA-PLRVDLEAQRIAIGELSVAFTIAPTWRTKLLNGWDDIDMTRQHAATIARFA 189 Query: 194 AK 195 + Sbjct: 190 TR 191 Lambda K H 0.322 0.138 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 139 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 201 Length of database: 210 Length adjustment: 21 Effective length of query: 180 Effective length of database: 189 Effective search space: 34020 Effective search space used: 34020 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
Align candidate WP_086508302.1 BZY95_RS01835 (3-isopropylmalate dehydratase small subunit)
to HMM TIGR00171 (leuD: 3-isopropylmalate dehydratase, small subunit (EC 4.2.1.33))
../bin/blast/fastacmd -i /tmp/list.16330.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.16330.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.