Align ABC transporter for L-Arginine and L-Citrulline, periplasmic substrate-binding component (characterized)
to candidate WP_086508344.1 BZY95_RS02040 transporter substrate-binding domain-containing protein
Query= reanno::pseudo3_N2E3:AO353_03055 (258 letters) >NCBI__GCF_002151265.1:WP_086508344.1 Length = 261 Score = 172 bits (437), Expect = 5e-48 Identities = 85/236 (36%), Positives = 142/236 (60%), Gaps = 3/236 (1%) Query: 22 DEKPLKIGIEAAYPPFASKAPDGSIVGFDYDIGNALCEEMKVKCVWVEQEFDGLIPALKV 81 D +++G++ Y PF + PDG + GF+ ++GNA+CE ++V C WVEQ++DG+IP L Sbjct: 25 DYSEIRLGVDIPYEPFMYRQPDGELTGFEIELGNAVCEYLEVTCTWVEQDWDGIIPGLMA 84 Query: 82 RKIDAILSSMSITDDRKKSVDFTNKYYNTPARLVMKAGTQVS-DNLAELKGKKIGVQRGS 140 R DAI+SSM+IT++R + V F+ YY TP+ + + ++ L G +GVQR + Sbjct: 85 RNYDAIMSSMAITEERAERVLFSEPYYTTPSAWITTRDRDIDIEDRDSLAGLVVGVQRAT 144 Query: 141 IHNRFAEEVLKPLGAEIKPYGSQNEIYLDVAAGRLDGTVADATLLDDGFLKTDSGKGFAF 200 + + + E+ L EI+ Y S +++ D+ AGRLD T D + ++ SG F Sbjct: 145 LQDNYVSELYGDL-VEIRRYTSADDVVTDMRAGRLDLTFMDYPVAENTMGIDTSGSHFKR 203 Query: 201 VGPAFTD-EKYFGDGIGIAVRKGDKAELDKINAAIVAIRANGKYKQIQDKYFNFDI 255 + + E FG G+G+A R+ D+A ++ N A+ A++ +G Y +I ++YFN+DI Sbjct: 204 ISGFIKEPEHIFGKGVGVAFRQRDEALAERFNEALAALKEDGTYDEIMERYFNYDI 259 Lambda K H 0.318 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 171 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 261 Length adjustment: 24 Effective length of query: 234 Effective length of database: 237 Effective search space: 55458 Effective search space used: 55458 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory