Align Polar amino acid ABC transporter, inner membrane subunit; Flags: Precursor (characterized, see rationale)
to candidate WP_086508347.1 BZY95_RS02055 ABC transporter
Query= uniprot:B2TBJ7 (240 letters) >NCBI__GCF_002151265.1:WP_086508347.1 Length = 233 Score = 165 bits (418), Expect = 6e-46 Identities = 86/235 (36%), Positives = 139/235 (59%), Gaps = 9/235 (3%) Query: 3 LIQMLGFGPEGWGGVLLLAALMTVALTLAALAVGAVFGALVAAAKLSRFRTLRVIGDIYT 62 +I + G+GP LL A +T+ L + +L + + G L A+AK+SR L + +YT Sbjct: 1 MIDLHGYGPR-----LLEGAGVTLQLAVLSLILALILGLLTASAKMSRNWLLHKVATLYT 55 Query: 63 TVFRGVPELLVIYLFYFGGSTLVT----SVGQLFGAEGFVGVPPFVVGALAVGMISGAYQ 118 TV RGVP+L+++ L +FGG + ++ FG + ++ + F G L +G I GAY Sbjct: 56 TVIRGVPDLVLMLLLFFGGQMALNVATDAIYDRFGVDWYINLNAFAAGVLTIGFIFGAYM 115 Query: 119 AEVYRSAVLAVSRGELEAARSIGMPTLTMARRILIPQVLRFALPGIGNVWQLSLKDSALI 178 E +R A +AV G++EA ++ GM + RRI PQ++R ALPGI N W + LK +AL+ Sbjct: 116 GETFRGAFMAVEHGQIEAGKAYGMSPWLVFRRIRFPQMMRHALPGISNNWMVLLKTTALV 175 Query: 179 SVTGLAELLRTSQVAAGSTHQYFTFFVVGGALYLIMTSISNRVFNRAEAHVGRSF 233 SV GL++++R + A+ +TH+ FTF + +YL++ S+S +F R + F Sbjct: 176 SVIGLSDMVRVAAEASRATHEPFTFLIPVAVVYLLIASVSEWMFARLQKRYNVGF 230 Lambda K H 0.327 0.141 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 120 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 233 Length adjustment: 23 Effective length of query: 217 Effective length of database: 210 Effective search space: 45570 Effective search space used: 45570 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory