Align Histidine transport system permease protein HisQ (characterized)
to candidate WP_086508347.1 BZY95_RS02055 ABC transporter
Query= SwissProt::P0A2I9 (228 letters) >NCBI__GCF_002151265.1:WP_086508347.1 Length = 233 Score = 227 bits (578), Expect = 2e-64 Identities = 116/226 (51%), Positives = 165/226 (73%), Gaps = 5/226 (2%) Query: 2 LYGFSGVILQGAIVTLELALSSVVLAVLIGLVGAGAKLSQNRVTGLIFEGYTTLIRGVPD 61 L+G+ +L+GA VTL+LA+ S++LA+++GL+ A AK+S+N + + YTT+IRGVPD Sbjct: 4 LHGYGPRLLEGAGVTLQLAVLSLILALILGLLTASAKMSRNWLLHKVATLYTTVIRGVPD 63 Query: 62 LVLMLLIFYGLQIALNVVTDSL----GID-QIDIDPMVAGIITLGFIYGAYFTETFRGAF 116 LVLMLL+F+G Q+ALNV TD++ G+D I+++ AG++T+GFI+GAY ETFRGAF Sbjct: 64 LVLMLLLFFGGQMALNVATDAIYDRFGVDWYINLNAFAAGVLTIGFIFGAYMGETFRGAF 123 Query: 117 MAVPKGHIEAATAFGFTHGQTFRRIMFPAMMRYALPGIGNNWQVILKATALVSLLGLEDV 176 MAV G IEA A+G + FRRI FP MMR+ALPGI NNW V+LK TALVS++GL D+ Sbjct: 124 MAVEHGQIEAGKAYGMSPWLVFRRIRFPQMMRHALPGISNNWMVLLKTTALVSVIGLSDM 183 Query: 177 VKATQLAGKSTWEPFYFAVVCGLIYLVFTTVSNGVLLLLERRYSVG 222 V+ A ++T EPF F + ++YL+ +VS + L++RY+VG Sbjct: 184 VRVAAEASRATHEPFTFLIPVAVVYLLIASVSEWMFARLQKRYNVG 229 Lambda K H 0.328 0.144 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 182 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 228 Length of database: 233 Length adjustment: 23 Effective length of query: 205 Effective length of database: 210 Effective search space: 43050 Effective search space used: 43050 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory