Align ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale)
to candidate WP_086508348.1 BZY95_RS02060 histidine/lysine/arginine/ornithine ABC transporter ATP-binding protein
Query= uniprot:A0A1N7U8S3 (276 letters) >NCBI__GCF_002151265.1:WP_086508348.1 Length = 256 Score = 291 bits (746), Expect = 7e-84 Identities = 155/249 (62%), Positives = 190/249 (76%), Gaps = 2/249 (0%) Query: 25 IKLQVEGIHKRYGEHEVLKGVSLNARQGDVISLIGASGSGKSTMLRCINFLEQPDAGVIT 84 I L+V I KR+G+ EVLKG+SL AR+GDVI+LIGASGSGKST LRC+N LEQPD G + Sbjct: 6 IPLEVRNIKKRFGDTEVLKGLSLEARKGDVITLIGASGSGKSTFLRCMNLLEQPDEGDLI 65 Query: 85 LDGISIEMRQGRAGTRAPHQDQLQNLRTRLAMVFQHFNLWSHMTVLENITMAPRRVLDVS 144 + G I + + G Q+ +R +L+MVFQ FNLWSHMT+LEN+ AP VL Sbjct: 66 VHGEEIRFKHTKHGREPADWKQVVRMRAKLSMVFQSFNLWSHMTLLENVIEAPIHVLGKP 125 Query: 145 AAEAEKRARMYLDKVGLPSRVADQYPAFLSGGQQQRVAIARALAMEPEIILFDEPTSALD 204 EA + AR LD+VGL +R AD YPA +SGGQQQR AIARALAM+PE++LFDEPTSALD Sbjct: 126 KKEAIEHARALLDRVGLTAR-ADAYPAQMSGGQQQRGAIARALAMDPEVMLFDEPTSALD 184 Query: 205 PELVGEVLKVIQTLAEEGRTMLMVTHEMGFARQVSSQVLFLHQGRVEEHGDAR-ILDQPN 263 PELVG+VLKV++ LAEEGRTM++VTHEMGFAR VSSQV++LHQG VEE G + +L P Sbjct: 185 PELVGDVLKVMRDLAEEGRTMVVVTHEMGFARDVSSQVIYLHQGLVEEAGPPQEVLVNPT 244 Query: 264 SERLQQFLS 272 S RL+QFL+ Sbjct: 245 SPRLKQFLA 253 Lambda K H 0.319 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 241 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 256 Length adjustment: 25 Effective length of query: 251 Effective length of database: 231 Effective search space: 57981 Effective search space used: 57981 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory