Align alcohol dehydrogenase (EC 1.1.1.1); long-chain-alcohol dehydrogenase (EC 1.1.1.192) (characterized)
to candidate WP_086508352.1 BZY95_RS02010 alcohol dehydrogenase
Query= BRENDA::A4IP64 (395 letters) >NCBI__GCF_002151265.1:WP_086508352.1 Length = 389 Score = 167 bits (423), Expect = 5e-46 Identities = 117/358 (32%), Positives = 182/358 (50%), Gaps = 13/358 (3%) Query: 8 FPPLSHVGWGALDQLVPEVKRLGAKHILVITDPMLVKIGLVDQVTSPLRQEGYSVHVYTD 67 +P G G + L K LG L++TDP L + +V + G V++ Sbjct: 10 YPSNILTGAGRIRDLPAACKALGMGAPLLVTDPGLAALPMVQACVQACQDAGLRTAVFSQ 69 Query: 68 VVPEPPLETGEKAVAFARDGKFDLVIGVGGGSALDLAKLAAVLA-VHDGSVADYLNLTGT 126 + P +A R G D VI GGGS LD AK A++A +G L G Sbjct: 70 IKGNPTGRNVLDGIAAFRGGSHDGVIAFGGGSGLDAAKAVALMANQREGLSLWSLEDIGD 129 Query: 127 --RTLEKKGL-PKILIPTTSGTGSEVTNISVLS--LETTKDVVTHDYLLADVAIVDPQLT 181 + + + + P + +PTT+GTGSEV SV++ E K ++ H ++ I+DP+LT Sbjct: 130 NWKNADARAIAPVVAVPTTAGTGSEVGRASVITDEAEHVKRIIFHPGMVPATVILDPELT 189 Query: 182 VSVPPRVTAATGIDALTHAVEAYVSVNASPTSDGLAVAAIRLISRSLRKAVANGSDKQAR 241 V +PP VTAATG+DAL+H +EA+ S P ++G+AV +R I L++A ++G+D +AR Sbjct: 190 VGLPPAVTAATGMDALSHCMEAWCSPLYHPMAEGIAVEGMRRIDLYLQRAYSDGADLEAR 249 Query: 242 IDMANGSYLAGLAFFNAGVAGVHALAYPLGGQFHIAHGESNAVLLPYVMGYIRQSCTKRM 301 ++M S + G F G+ +HALA+PLG + HG NAVL+PYV+ ++ + M Sbjct: 250 MNMLVASSM-GATAFQRGLGAMHALAHPLGALYDAHHGTLNAVLMPYVLRANERAIGEPM 308 Query: 302 ADIFNALGGNSSFLSEVEASYRCVEELERFVADVGIPKTLGGFGIPESALESLTKDAV 359 + L + + V +E + +GIP TL GI + + + AV Sbjct: 309 VRLGRYLNLDQPGTAAV------IEWVLGLRERLGIPHTLAELGIDTRQADKVGRMAV 360 Lambda K H 0.318 0.135 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 366 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 389 Length adjustment: 31 Effective length of query: 364 Effective length of database: 358 Effective search space: 130312 Effective search space used: 130312 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory