Align Monocarboxylic acid transporter (characterized)
to candidate WP_086508553.1 BZY95_RS03245 cation acetate symporter
Query= SwissProt::Q8NS49 (551 letters) >NCBI__GCF_002151265.1:WP_086508553.1 Length = 598 Score = 150 bits (378), Expect = 2e-40 Identities = 87/273 (31%), Positives = 135/273 (49%), Gaps = 5/273 (1%) Query: 49 DFYTGGASFSGTQNGLAIAGDYLSAASFLGIVGAISLNGYDGFLYSIGFFVAWLVALLLV 108 DFY G NG+A A D++SAASF+ + G ++ GY + +G+ +++ +L+ Sbjct: 32 DFYVAGGGVHPVTNGMATAADWMSAASFISMAGLLASGGYANSTFLMGWTGGYVILAMLL 91 Query: 109 AEPLRNVGRFTMADVLSFRLRQKPVRVAAACGTLAVTLFYLIAQMAGAGSLVSVLLDIHE 168 A LR G+FT+ D + R K RV A + ++ Y+I QM GAG S L++ Sbjct: 92 APYLRKFGKFTVPDFIGDRFYSKTARVVAVICLIVASVTYVIGQMTGAGVAFSRFLEVPS 151 Query: 169 FKWQAVVVGIVGIVMIAYVLLGGMKGTTYVQMIKAVLLVGGVAIMTVLTFVKVSGGLTTL 228 + GIV Y + GGMKG TY Q+ + ++L+ I V ++++G + Sbjct: 152 STGIWIAAGIV----FLYAVFGGMKGITYTQVAQYIVLIIAYTIPAVFIAMQLTGNPIPM 207 Query: 229 LNDAVEKHAASDYAATKGYDPTQILEPGLQYGATLTTQLDFISLALALCLGTAGLPHVLM 288 H S D Y A + +L+ + L+L +GTAGLPHV++ Sbjct: 208 FG-MFSTHTESGVPLLAKLDEVVTALGFRDYTADVDNKLNMVLFTLSLMIGTAGLPHVII 266 Query: 289 RFYTVPTAKEARKSVTWAIVLIGAFYLMTLVLG 321 RF+TVP +AR S WA+V I YL +G Sbjct: 267 RFFTVPKVADARWSAGWALVFIALLYLTAPAVG 299 Score = 65.9 bits (159), Expect = 4e-15 Identities = 41/122 (33%), Positives = 68/122 (55%), Gaps = 2/122 (1%) Query: 357 MALISAVAFATVLAVVAGLAITASAAVGHDIYNAVIRNGQSTEAEQVRVSRITVVVIGLI 416 + LI+A A L+ AGL + S+A+ HD+ I N +E ++ +RI++ L+ Sbjct: 404 IGLIAAGGIAAALSTAAGLLLAISSAISHDLIKNTI-NPSISEKGEMLAARISMAGAILL 462 Query: 417 SIVLGILAMTQNVAFLVALAFAVAASANLPTILYSLYWKKFNTTGAVAAIYTGLISALLL 476 + LG L A +VALAF +AA++ P ++ ++ + N+ GA+ + GLIS LL Sbjct: 463 ATYLG-LNPPGFAAQVVALAFGIAAASLFPVLMMGIFSTRMNSKGAICGMLAGLISTLLY 521 Query: 477 IF 478 IF Sbjct: 522 IF 523 Lambda K H 0.324 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 673 Number of extensions: 31 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 551 Length of database: 598 Length adjustment: 36 Effective length of query: 515 Effective length of database: 562 Effective search space: 289430 Effective search space used: 289430 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory