Align BadI (characterized)
to candidate WP_086508572.1 BZY95_RS03335 enoyl-CoA hydratase-related protein
Query= metacyc::MONOMER-892 (260 letters) >NCBI__GCF_002151265.1:WP_086508572.1 Length = 265 Score = 363 bits (932), Expect = e-105 Identities = 168/258 (65%), Positives = 212/258 (82%) Query: 3 FEDLIYEIRNGVAWIIINRPDKMNAFRGTTCDELIKALYKAGYDKDVGAIVLAGAGDRAF 62 +ED++Y++ +GVA I INRP++ NAFRG TC EL+ A +AG+DK VG IVL GAGD+AF Sbjct: 8 YEDVLYDVTDGVATITINRPERYNAFRGQTCMELLDAFNRAGWDKSVGVIVLTGAGDKAF 67 Query: 63 CTGGDQSTHDGNYDGRGTVGLPMEELHTAIRDVPKPVIARVQGYAIGGGNVLATICDLTI 122 CTGGDQ H+G YDGRG +GLP+EEL T IR VPKPVIARV G+AIGGG+VL +CDL+I Sbjct: 68 CTGGDQGAHEGQYDGRGIIGLPVEELQTLIRQVPKPVIARVNGFAIGGGHVLHVVCDLSI 127 Query: 123 CSEKAIFGQVGPKMGSVDPGYGTAFLARVVGEKKAREIWYMCKRYSGKEAEAMGLANLCV 182 +E AIFGQVGPK+GSVDPG+GTA+LARV+GEK+AREIWY+C++YS +A GL N V Sbjct: 128 AAETAIFGQVGPKVGSVDPGFGTAYLARVIGEKRAREIWYLCRKYSAAQALEWGLVNAVV 187 Query: 183 PHDELDAEVQKWGEELCERSPTALAIAKRSFNMDTAHQAGIAGMGMYALKLYYDTDESRE 242 P ++LD EV++W +E+ E+SPTAL+IAKRSFN D+ + AGI +GM AL LYY+TDESRE Sbjct: 188 PPEQLDEEVRRWCDEILEKSPTALSIAKRSFNADSENIAGIGALGMQALSLYYETDESRE 247 Query: 243 GVKALQEKRKPEFRKYIK 260 GV A +EKR+PEFRK+ K Sbjct: 248 GVAAFKEKRRPEFRKFYK 265 Lambda K H 0.319 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 307 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 265 Length adjustment: 25 Effective length of query: 235 Effective length of database: 240 Effective search space: 56400 Effective search space used: 56400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory