Align 3-oxoadipate CoA-transferase (EC 2.8.3.6) (characterized)
to candidate WP_086508614.1 BZY95_RS03580 CoA transferase subunit A
Query= reanno::pseudo3_N2E3:AO353_17195 (285 letters) >NCBI__GCF_002151265.1:WP_086508614.1 Length = 276 Score = 391 bits (1005), Expect = e-114 Identities = 191/269 (71%), Positives = 222/269 (82%), Gaps = 4/269 (1%) Query: 1 MAEILSLHDAVKQFVNDGDTVALEGFTHLIPTAAGHEIIRQGKKDLTLVRMTPDLVYDQL 60 MAE LSL DAV ++V DG TVA+EGFTHLIP AAGHE+IRQ K+DLTL+RMTPDLVYDQ+ Sbjct: 1 MAEFLSLRDAVARYVEDGATVAMEGFTHLIPFAAGHEVIRQKKRDLTLIRMTPDLVYDQM 60 Query: 61 IGAGCARKLIFSWGGNPGVGSLHRLRDAVEKQWPHALEIEEHSHADLANAYVAGASGLPF 120 IGAGCARK+IFSWGGNPGVGSLHRLRDAVEK WPH +EI EHSHA +A A+ AGA+GLP Sbjct: 61 IGAGCARKVIFSWGGNPGVGSLHRLRDAVEKGWPHKVEILEHSHAAMACAFEAGAAGLPL 120 Query: 121 AVLRAYAGSDLPKVNPLIKSVTCPFTGEVLAAVPSVRPDVTVIHAQKADRKGNVLLWGIL 180 AVLR Y GS+LP VN IK + CPFTGE LAAVP+VRPDV+++HAQKADR GNVL+ GI+ Sbjct: 121 AVLRGYVGSELPSVNDQIKFIECPFTGERLAAVPAVRPDVSIVHAQKADRAGNVLVEGIV 180 Query: 181 GVQKEAALAAKRCIVTVEEIVDDLKAPM----NACVLPTWALSAVCHVPGGAHPSYAHGY 236 GVQKEA LAAK+ IVTVEEIVDDL+A NAC++P WA+SA+ G+ PSYAHGY Sbjct: 181 GVQKEAVLAAKQSIVTVEEIVDDLRAEADYHPNACIIPGWAISAIAVAEKGSLPSYAHGY 240 Query: 237 TERDNRFYQAWDPIARDRETFTAWINEYI 265 R+N FY+ WD IARDR+TFT WI E + Sbjct: 241 YPRNNAFYKEWDGIARDRDTFTRWIEENV 269 Lambda K H 0.320 0.135 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 315 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 285 Length of database: 276 Length adjustment: 26 Effective length of query: 259 Effective length of database: 250 Effective search space: 64750 Effective search space used: 64750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory