Align Alr3027 protein, component of The 2-oxo monocarboxylate transporter (Pernil et al., 2010). Transports pyruvate which is inhibited by various 2-ketoacids (characterized)
to candidate WP_086508654.1 BZY95_RS03790 TRAP transporter large permease subunit
Query= TCDB::Q8YSQ7 (445 letters) >NCBI__GCF_002151265.1:WP_086508654.1 Length = 444 Score = 364 bits (935), Expect = e-105 Identities = 196/445 (44%), Positives = 286/445 (64%), Gaps = 7/445 (1%) Query: 1 MTLAYEWLGPVMFAGALVLLSSGYPVAFSLGGVAILFGLLGIGLGVFDPIFLTAMPQRIF 60 M L+ E L VMF G L+ L G+P+AF LGG+A++ LG G V I I+ Sbjct: 1 MNLSPELLTLVMFGGLLIGLFMGHPLAFVLGGIAVIGAYLGPGERVLGTII-----NNIY 55 Query: 61 G-IMANYTLLAIPYFIFMGAMLEKSGIAERLLETMGILLGRLRGGLALAVVLVGALLAAT 119 G M NY L+AIP F+ M L SG+ E++ M +LL LRGGLAL VV+V +LAAT Sbjct: 56 GNAMDNYVLVAIPLFVLMARFLNDSGVTEKMFAVMRLLLANLRGGLALTVVIVSVMLAAT 115 Query: 120 TGVVAATVVAMGLISLPIMLRYGYNKELATGVIAASGTLGQIIPPSVVLVVLGDQLGISV 179 TG+V A++ MG+I+L ML++GYNKEL+TGVI ASG LG +IPPS++L+++ +SV Sbjct: 116 TGIVGASIAVMGMIALVPMLKHGYNKELSTGVIMASGCLGILIPPSIMLILMASYSPVSV 175 Query: 180 GDLFIGSVIPGLMMASAFALHVLIVAFIRPDVAPALPAQVR-EIGGKALGKRVIQVMIPP 238 G LF G+++PGLM+ + +AL+VL++ +I+P P +P + R E L + + ++PP Sbjct: 176 GALFAGALVPGLMLGAMYALYVLVICYIKPAYGPPVPTEERAETSTGQLLLMLAKYVLPP 235 Query: 239 LILILLVLGSIFFGFATPTEAGAVGCAGAIALAAANGQFTLESLRQVCDTTLRITSMVVF 298 + LIL VLG++F G AT TEA A+G A A L G L++ + T+MV+ Sbjct: 236 MALILGVLGALFTGVATATEASAIGVAIAFLLFLIFGDRRLKTCFNTLIEAGKTTTMVML 295 Query: 299 ILIGSTAFSLVFRGLNGDQFMFDVLANLPGGKIGFLFVSMTTVFLLGFFIDFFEIAFIVI 358 +L+G+TAF+ VF G + D++ +PGG G L + + VFLLG F+D+ I + Sbjct: 296 VLVGATAFTGVFSRGGGMTVISDLVLAMPGGTTGALILMLFLVFLLGMFLDWTGIVLLSF 355 Query: 359 PLFVPVAQKLGIDLVWYGVILGANLQTSFLTPPFGFALFYLRGVAPPEVTTSDIYRGVIP 418 P+ +P+ ++G+D++W+ V++ LQTSFLTPPFG+ALFYL+GVAP V D+YR V+P Sbjct: 356 PIMLPIVNQMGVDVLWFVVMVAVVLQTSFLTPPFGYALFYLKGVAPKGVEIVDLYRAVVP 415 Query: 419 FILLQLLVLLLIIIFPGIVSFLPSL 443 F L +L +L+ FP +V+ LPSL Sbjct: 416 FCALIVLACVLMAFFPVLVTGLPSL 440 Lambda K H 0.331 0.149 0.437 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 571 Number of extensions: 31 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 444 Length adjustment: 32 Effective length of query: 413 Effective length of database: 412 Effective search space: 170156 Effective search space used: 170156 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory