GapMind for catabolism of small carbon sources

 

Alignments for a candidate for nbaF in Halomonas desiderata SP1

Align 2-aminomuconate deaminase; EC 3.5.99.5 (characterized)
to candidate WP_086509065.1 BZY95_RS06010 RidA family protein

Query= SwissProt::Q9KWS2
         (142 letters)



>NCBI__GCF_002151265.1:WP_086509065.1
          Length = 129

 Score = 60.8 bits (146), Expect = 7e-15
 Identities = 33/108 (30%), Positives = 55/108 (50%), Gaps = 9/108 (8%)

Query: 19  MGSFPHVKRAGDFLFVSGTSSRRPDNTFVGAEPDDTGRPRPNIELQTREVISNIRDILQS 78
           +G +    +AG+ +++SG          +  +P        + E Q R+V  N++ + + 
Sbjct: 16  IGPYSQAIKAGNTVYLSGQ---------IPLDPATMELVSDDFEAQARQVFINLKAVCEE 66

Query: 79  VGADLGDVVEVCSYLVNMNDFAAYNKVYAEFFDATGPARTTVAVHQLP 126
               LG++V++  YLV++ +FA  NKV  EFFD   PAR  V V  LP
Sbjct: 67  AAGSLGEIVKLNLYLVDLGNFAVVNKVMEEFFDKPYPARAAVGVKALP 114


Lambda     K      H
   0.318    0.135    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 46
Number of extensions: 3
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 142
Length of database: 129
Length adjustment: 15
Effective length of query: 127
Effective length of database: 114
Effective search space:    14478
Effective search space used:    14478
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 42 (20.8 bits)

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory