Align N-carbamoylputrescine amidase; Nitrilase-like protein 1; EC 3.5.1.53 (characterized)
to candidate WP_086509072.1 BZY95_RS05890 acyltransferase
Query= SwissProt::Q8VYF5 (299 letters) >NCBI__GCF_002151265.1:WP_086509072.1 Length = 288 Score = 193 bits (490), Expect = 4e-54 Identities = 108/259 (41%), Positives = 154/259 (59%), Gaps = 14/259 (5%) Query: 33 LVREAHAKGANIILIQELFEGYYFCQAQREDFFKRAKPYKNHPTIARMQKLAKELGVVIP 92 L+++A G ++ QE+F YFC +Q ++ A+ + PT MQKLA E +V+ Sbjct: 35 LIQQAAQAGVQVLCFQEVFNQPYFCPSQDPKWYAAAERVPDGPTCRMMQKLAAEHRMVMI 94 Query: 93 VSFFEEANTA-HYNSIAIIDADGTDLGIYRKSHIPDGPGYQEKFYFNPGDTGFKVFQTKF 151 V +EE T +YNS A+ DADG+ LG Y K+HIP G+ EKF+F PG +G+ VF T + Sbjct: 95 VPIYEETVTGVYYNSAAVFDADGSYLGKYHKTHIPQVAGFWEKFFFKPGRSGWPVFDTAY 154 Query: 152 AKIGVAICWDQWFPEAARAMVLQGAEILFYPTAIGSEPQDQGLDSRDHWRRVMQGHAGAN 211 KIGV IC+D+ FPE RA+ L GAE++F P+A + GL S+ W A AN Sbjct: 155 GKIGVYICYDRHFPEGWRALALNGAEVIFNPSATVA-----GL-SQYLWELEQPASAAAN 208 Query: 212 VVPLVASNRIGKEIIETEHGPSQI-TFYGTSFIAGPTGEIVAEADDKSEAVLVAQFDLDM 270 + A NR+G E P I FYG+S+I P G+I A+A D+++ +LV + DL M Sbjct: 209 GCFIAAINRVGSE------APWNIGEFYGSSYIVNPRGQIEAQASDRADELLVHEIDLAM 262 Query: 271 IKSKRQSWGVFRDRRPDLY 289 ++ R +W FRDRRP+ Y Sbjct: 263 VREIRNNWQFFRDRRPEAY 281 Lambda K H 0.321 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 258 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 288 Length adjustment: 26 Effective length of query: 273 Effective length of database: 262 Effective search space: 71526 Effective search space used: 71526 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory