Align NAD-dependent glycerol dehydrogenase; Dha-forming NAD-dependent glycerol dehydrogenase; EC 1.1.1.6 (characterized)
to candidate WP_086509102.1 BZY95_RS06205 2-deoxy-D-gluconate 3-dehydrogenase
Query= SwissProt::Q92EU6 (254 letters) >NCBI__GCF_002151265.1:WP_086509102.1 Length = 250 Score = 133 bits (335), Expect = 3e-36 Identities = 83/246 (33%), Positives = 142/246 (57%), Gaps = 6/246 (2%) Query: 10 FNITDKVAVVTGAASGIGKAMAELFSEKGAYVVLLD-IKEDVKDVAAQINPSRTLALQVD 68 F++ +VA+VTG G+G+ +A +E GA +V ++ D + R +A++ + Sbjct: 4 FDLHGRVAMVTGCNKGLGQGLALALAEAGADIVGVNRSNSDETREKVEALGRRYVAVEAE 63 Query: 69 ITKKENIEKVVAEIKKVYPKIDILANSAGVALLEKAEDLPEEYWDKTMELNLKGSFLMAQ 128 + + + E +VA + ++D+L N+AG A EE W+ +++NLK +F +AQ Sbjct: 64 LGR-DTPEAIVARALESTGRLDMLINNAGAIRRAPALTFTEEDWEAVVDVNLKAAFFLAQ 122 Query: 129 IIGREMIATGG-GKIVNMASQASVIALDKHVAYCASKAAIVSMTQVLAMEWAPYNINVNA 187 + R ++ G G+IVN+AS S + AY ASK+ ++ +T++LA EWA + I VNA Sbjct: 123 AVARHLVERGAPGRIVNVASVLSFQGGIRVPAYTASKSGLLGLTRLLANEWAAHGITVNA 182 Query: 188 ISPTVILTE--LGKKAWAGQVGEDMKKLIPAGRFGYPEEVAACALFLVSDAASLITGENL 245 I+P + T+ + A + E + + IPAGR+G PE++A +FL SDAA+ + G L Sbjct: 183 IAPGYMATDNTQALREDATRSAEILGR-IPAGRWGTPEDLAGAVIFLCSDAAAYVNGHAL 241 Query: 246 IIDGGY 251 +DGG+ Sbjct: 242 AVDGGW 247 Lambda K H 0.316 0.133 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 144 Number of extensions: 5 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 250 Length adjustment: 24 Effective length of query: 230 Effective length of database: 226 Effective search space: 51980 Effective search space used: 51980 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory