Align Iron-sulfur cluster-binding protein, putative (characterized, see rationale)
to candidate WP_086509118.1 BZY95_RS06300 formate dehydrogenase subunit alpha
Query= uniprot:Q39TW6 (218 letters) >NCBI__GCF_002151265.1:WP_086509118.1 Length = 971 Score = 100 bits (248), Expect = 1e-25 Identities = 71/235 (30%), Positives = 103/235 (43%), Gaps = 32/235 (13%) Query: 4 INLQIDGKEVVATEGMTILDAAKSVGISIPTLCHHEKLEPYGGCRICTVEVEVRGWPKLV 63 ++L+IDG + EG ++L AA I+IP LC + LE +G CR+C V++E G L Sbjct: 33 VSLEIDGVAITVPEGTSVLRAAALADINIPKLCASDNLEAFGSCRLCAVQIE--GRRGLP 90 Query: 64 AGCIYPVEKGLVVRTRNEKIDKIRKVLLEEMLAHAP---------DSEELKALA------ 108 A C PV G+ V T+N ++ K+R+ ++E ++ P EL+ +A Sbjct: 91 ASCTTPVAAGMKVTTQNARLAKLRRNVMELYISDHPLDCLTCPANGDCELQDMAGVVGLR 150 Query: 109 -QEYGADRDR------------FEKHPSFCIHCGLCVRYCAEIKKKNAVGFVDRGSNREI 155 YG D + F PS CI C CVR C E++ A+ RG ++ Sbjct: 151 EVRYGFDGENHLDAETDDSNPYFSFDPSKCIVCSRCVRACEEVQGTFALTIEGRGFESKV 210 Query: 156 SFIPEIA--AKECWDCKECFPLCPTSALQAAYVLAGALMTPPEEAHSGGCGCSCS 208 + A EC C C CPTS L V+ CG CS Sbjct: 211 AAGQSEAFMDSECVSCGACVQACPTSTLMEKSVIEQGQPEHSVVTTCAYCGVGCS 265 Lambda K H 0.320 0.137 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 508 Number of extensions: 31 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 218 Length of database: 971 Length adjustment: 33 Effective length of query: 185 Effective length of database: 938 Effective search space: 173530 Effective search space used: 173530 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory