Protein WP_086509379.1 in Billgrantia desiderata SP1
Annotation: NCBI__GCF_002151265.1:WP_086509379.1
Length: 580 amino acids
Source: GCF_002151265.1 in NCBI
Candidate for 12 steps in catabolism of small carbon sources
Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
D-fructose catabolism | fruA | hi | Phosphotransferase system transporter fructose-specific IIBC component, FruA, component of Fructose-specific PTS permease, FruIIBC/FruI-HPr-IIA (characterized) | 62% | 99% | 687.6 | The fructose porter, FruA (fructose-1-P forming IIABC) (Delobbe et al. 1975) FruA is 39% identical to 4.A.2.1.1). fructose can be metabolized to Fru-1-P via this system as well as Fru-6-P by another PTS system | 46% | 424.9 |
sucrose catabolism | fruA | hi | Phosphotransferase system transporter fructose-specific IIBC component, FruA, component of Fructose-specific PTS permease, FruIIBC/FruI-HPr-IIA (characterized) | 62% | 99% | 687.6 | The fructose porter, FruA (fructose-1-P forming IIABC) (Delobbe et al. 1975) FruA is 39% identical to 4.A.2.1.1). fructose can be metabolized to Fru-1-P via this system as well as Fru-6-P by another PTS system | 46% | 424.9 |
D-fructose catabolism | fruII-ABC | med | The fructose porter, FruA (fructose-1-P forming IIABC) (Delobbe et al. 1975) FruA is 39% identical to 4.A.2.1.1). fructose can be metabolized to Fru-1-P via this system as well as Fru-6-P by another PTS system (characterized) | 46% | 79% | 424.9 | Phosphotransferase system transporter fructose-specific IIBC component, FruA, component of Fructose-specific PTS permease, FruIIBC/FruI-HPr-IIA | 62% | 687.6 |
sucrose catabolism | fruII-ABC | med | The fructose porter, FruA (fructose-1-P forming IIABC) (Delobbe et al. 1975) FruA is 39% identical to 4.A.2.1.1). fructose can be metabolized to Fru-1-P via this system as well as Fru-6-P by another PTS system (characterized) | 46% | 79% | 424.9 | Phosphotransferase system transporter fructose-specific IIBC component, FruA, component of Fructose-specific PTS permease, FruIIBC/FruI-HPr-IIA | 62% | 687.6 |
D-mannose catabolism | manP | med | protein-Npi-phosphohistidine-D-mannose phosphotransferase (EC 2.7.1.191) (characterized) | 45% | 72% | 401.7 | Phosphotransferase system transporter fructose-specific IIBC component, FruA, component of Fructose-specific PTS permease, FruIIBC/FruI-HPr-IIA | 62% | 687.6 |
xylitol catabolism | fruI | med | The fructose inducible fructose/xylitol porter, FruI (characterized) | 41% | 79% | 347.8 | Phosphotransferase system transporter fructose-specific IIBC component, FruA, component of Fructose-specific PTS permease, FruIIBC/FruI-HPr-IIA | 62% | 687.6 |
D-fructose catabolism | fruII-C | med | Sugar phosphotransferase system IIC component, component of Fructose-specific Enzyme I-HPr-Enzyme IIABC complex, all encoded within a single operon with genes in the order: ptsC (IIC), ptsA (IIA), ptsH (HPr), ptsI (Enzyme I) and ptsB (IIB) (characterized) | 44% | 92% | 302.4 | Phosphotransferase system transporter fructose-specific IIBC component, FruA, component of Fructose-specific PTS permease, FruIIBC/FruI-HPr-IIA | 62% | 687.6 |
sucrose catabolism | fruII-C | med | Sugar phosphotransferase system IIC component, component of Fructose-specific Enzyme I-HPr-Enzyme IIABC complex, all encoded within a single operon with genes in the order: ptsC (IIC), ptsA (IIA), ptsH (HPr), ptsI (Enzyme I) and ptsB (IIB) (characterized) | 44% | 92% | 302.4 | Phosphotransferase system transporter fructose-specific IIBC component, FruA, component of Fructose-specific PTS permease, FruIIBC/FruI-HPr-IIA | 62% | 687.6 |
D-ribose catabolism | fru2-IIB | med | PTS system, fructose-specific, IIB component, component of D-allose/D-ribose transporting Enzyme II complex (Fru2; IIA/IIB/IIC) (Patron et al. 2017). This system is similar to Frz of E. coli (TC#4.A.2.1.9) which is involved in environmental sensing, host adaptation and virulence (characterized) | 46% | 98% | 99.8 | Phosphotransferase system transporter fructose-specific IIBC component, FruA, component of Fructose-specific PTS permease, FruIIBC/FruI-HPr-IIA | 62% | 687.6 |
D-fructose catabolism | fruII-B | med | PTS system, fructose-specific, IIB subunnit, component of Fructose Enzyme II complex (IIAFru - IIBFru - IICFru) (based on homology) (characterized) | 40% | 83% | 91.3 | Phosphotransferase system transporter fructose-specific IIBC component, FruA, component of Fructose-specific PTS permease, FruIIBC/FruI-HPr-IIA | 62% | 687.6 |
sucrose catabolism | fruII-B | med | PTS system, fructose-specific, IIB subunnit, component of Fructose Enzyme II complex (IIAFru - IIBFru - IICFru) (based on homology) (characterized) | 40% | 83% | 91.3 | Phosphotransferase system transporter fructose-specific IIBC component, FruA, component of Fructose-specific PTS permease, FruIIBC/FruI-HPr-IIA | 62% | 687.6 |
D-ribose catabolism | fru2-IIC | lo | PTS system, fructose-specific, IIC component, component of D-allose/D-ribose transporting Enzyme II complex (Fru2; IIA/IIB/IIC) (Patron et al. 2017). This system is similar to Frz of E. coli (TC#4.A.2.1.9) which is involved in environmental sensing, host adaptation and virulence (characterized) | 37% | 92% | 222.2 | Phosphotransferase system transporter fructose-specific IIBC component, FruA, component of Fructose-specific PTS permease, FruIIBC/FruI-HPr-IIA | 62% | 687.6 |
Sequence Analysis Tools
View WP_086509379.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MNVIIVTACPSGMATTFLAARRLEQAARRLGWQASIEMHSQLEAVEPVSADAIAAAELIV
VAADQIPAAERFAGKQLFRAAIGEALPDPEAFLQRAQREAESFTPPAQSAAANQHKAPGG
SKIVAVTACPTGVAHTFMAAEALSEAGKSLGHEIRVETQGSVGAQNKLTDEEIAAADVVI
LACDIEVDPTRFAGKRIYRTSTGNALKKPRPTIEAALDQAEVEDSGTARRSDASRSIKEK
GVYKHLLTGVSFMLPMVVAGGLLIALSFVFGIEAFQEEGTLAAALMQIGGGTAFALMIPV
LAGYIAYSIADRPGIAPGMIGGMLAANIEAGFIGGIIAGFLAGYVALAVTRHVKLPASVE
SLKPILIIPLVSSLVTGLTMIYIIGEPVAAILAGLTGFLAGMDATNAVLLGILLGAMMCF
DLGGPVNKAAYTFGVGLLASQTYAPMAAIMAAGMVPAIGMGIASFVARHKFSEPEREAGK
ASFVLGLCFISEGAIPFAAKDPLRVIPACIAGGAVTGALSMLVGAQLMAPHGGIFVLLIP
NAITPVLLYLGAIVIGSLVTGLGYAAIKRGAAPVAVGATA
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory