Align arylformamidase (EC 3.5.1.9) (characterized)
to candidate WP_086509445.1 BZY95_RS08145 alpha/beta hydrolase
Query= metacyc::MONOMER-19505 (304 letters) >NCBI__GCF_002151265.1:WP_086509445.1 Length = 283 Score = 133 bits (335), Expect = 4e-36 Identities = 91/258 (35%), Positives = 122/258 (47%), Gaps = 16/258 (6%) Query: 15 LDRQYSPSTTVPSLQAYLDDYRRISADARRRHPVRAGLAYGPHPAELLDYFPATGRSDAP 74 +DR+Y P A L D++ S R+R V LA+GP AE +D + A AP Sbjct: 12 IDREYDPMRGRDPA-ALLGDWQARSNALRKRCRVTENLAFGPTLAECMDVYHAEAEG-AP 69 Query: 75 LLVFVHGGNWQALGRAESAFAVPALLAAGAAVAVVEYGLAPDTPLEAMAGMVRRSVAWLL 134 L +F HGG W++LG E F L AG +VAVV Y L P + R +VAW Sbjct: 70 LHLFFHGGYWRSLGHREFGFVAEGLREAGISVAVVNYALCPTVAFGEVVRQARAAVAWAY 129 Query: 135 RHADALGFAPDRLHLCGTSAGAHLAAMALLPH-------PDDGPDTSGRIAGAVLLSGIY 187 RH +LG P RL + G SAG HL AM L PDD + GA+ +SG+Y Sbjct: 130 RHGASLGVDPSRLSVSGHSAGGHLTAMLLATDWQGVYGLPDD------LLEGALCVSGLY 183 Query: 188 DLEPVQLSYVNDALRLDGAGARRNSPLLRLPPRLPPLVVARGDNETEEYVRQHEQMVAAL 247 DL P S++ L+L G SPL + P+ + G E+ E+ RQ L Sbjct: 184 DLRPFPWSWLQPKLQLTGRDVTDYSPLFQPCRVAAPVHLVAGGEESTEFARQMHAHAEHL 243 Query: 248 RARAAVTEV-VAERRDHF 264 A+ V ++ DHF Sbjct: 244 EAQGMVVSAELSPGDDHF 261 Lambda K H 0.319 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 195 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 304 Length of database: 283 Length adjustment: 26 Effective length of query: 278 Effective length of database: 257 Effective search space: 71446 Effective search space used: 71446 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory