Align ABC-type branched-chain amino acid transport system, permease component protein (characterized, see rationale)
to candidate WP_086509451.1 BZY95_RS08175 branched-chain amino acid ABC transporter permease
Query= uniprot:D8IUY4 (309 letters) >NCBI__GCF_002151265.1:WP_086509451.1 Length = 304 Score = 152 bits (383), Expect = 1e-41 Identities = 96/310 (30%), Positives = 161/310 (51%), Gaps = 21/310 (6%) Query: 1 MDIFIQQIINGLVLGSMYALIALGYTMVYGVLNLINFAHGDILMVGAMVGLSLLKVVQQV 60 M +FI+Q+INGL LG+M L+A G T+V+GV+ LIN AHG MVGA + Sbjct: 1 MTLFIEQLINGLQLGTMLFLMASGLTLVFGVMGLINLAHGSFYMVGAYA-----TALVTA 55 Query: 61 APGLPGIVQLVIAIVGAIPVCIVVSLLIERIAYRPLRNAPRLAPLITAIGVSILLQTLAM 120 A G + + I V V L+E I R L + P L ++ + ++ Sbjct: 56 ATG-----SFFVGLAAGIAVAAAVGALVELIVIRRLYHRPHLDQVLATFALILIFSEGTR 110 Query: 121 MIWGRSPLPF-PQVMPSDPVHIAGALISPT-QIMLLALAVLAMVGLVLIVEKTKMGRAMR 178 ++G SPL P M + V + G L P +++++A+ V VG+ ++ +T++G +R Sbjct: 111 WLFGSSPLWLNPPAMLAGSVTLPGGLRYPIYRLVIIAVGVAVAVGMYFLITRTRLGMRIR 170 Query: 179 ATAENPRIAGLMGVDANKVIVVTFAIGAGLAAIAGVMWAANYSTAQFAMGFVPGLKAFSA 238 A + + G +G++ ++ + FA+GA LA +AG M A + Q MG + AF Sbjct: 171 AGESDREMIGALGINIARLYTLVFAMGAALAGLAGAMVGA-LQSVQVGMGEPVLILAFVV 229 Query: 239 AVLGGIGNIYGAMLGGILLGLIESLGAGYIGDLTGNFL--------GSNYQDIFAFIVLI 290 V+GGIG+I GA+ G IL+G++++LG ++ F+ GS + +I++ Sbjct: 230 IVIGGIGSIKGALYGAILVGVVDTLGRVFLPAFFRQFMSPSEAAGVGSAIAAMLIYIMMA 289 Query: 291 IVLTLRPSGI 300 +L +P G+ Sbjct: 290 AILAFKPKGL 299 Lambda K H 0.328 0.144 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 256 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 304 Length adjustment: 27 Effective length of query: 282 Effective length of database: 277 Effective search space: 78114 Effective search space used: 78114 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory