Align butanoyl-CoA dehydrogenase (NAD+, ferredoxin) (subunit 3/3) (EC 1.3.1.109); short-chain acyl-CoA dehydrogenase (EC 1.3.8.1) (characterized)
to candidate WP_086509502.1 BZY95_RS08430 acyl-CoA dehydrogenase
Query= BRENDA::Q18AQ1 (378 letters) >NCBI__GCF_002151265.1:WP_086509502.1 Length = 385 Score = 254 bits (650), Expect = 2e-72 Identities = 140/361 (38%), Positives = 206/361 (57%), Gaps = 1/361 (0%) Query: 18 FAENEVKPLATELDEEERFPYETVEKMAKAGMMGIPYPKEYGGEGGDTVGYIMAVEELSR 77 F E EV P +E P +++ +AG++GI P+ GG G D +A+EE+SR Sbjct: 19 FLEQEVAPHYEAWEEAGEMPRSLWQQLGEAGLLGIDLPEALGGSGADFAIVQLALEEISR 78 Query: 78 V-CGTTGVILSAHTSLGSWPIYQYGNEEQKQKFLRPLASGEKLGAFGLTEPNAGTDASGQ 136 G + H ++ + G Q++++L +ASGE +GA +TEP AG+D + Sbjct: 79 QGFGGLASAYNIHANIVMPYLLHIGTPAQRERWLPAMASGETIGAIAMTEPGAGSDLAAM 138 Query: 137 QTTAVLDGDEYILNGSKIFITNAIAGDIYVVMAMTDKSKGNKGISAFIVEKGTPGFSFGV 196 +T A + L+GSK+FITN D+ +V A TD + G +G+S F+V+ GFS G Sbjct: 139 KTRASRTESGWRLDGSKLFITNGQIADLVIVCAKTDPAAGARGVSLFLVDTTLAGFSRGQ 198 Query: 197 KEKKMGIRGSATSELIFEDCRIPKENLLGKEGQGFKIAMSTLDGGRIGIAAQALGLAQGA 256 KK+G S T+EL F+D R+P+E LLG+ G GF M L R+G+AAQALG +GA Sbjct: 199 PIKKIGQHASDTAELFFDDLRLPEEALLGEAGAGFAYLMQELPRERLGVAAQALGAMEGA 258 Query: 257 LDETVKYVKERVQFGRPLSKFQNTQFQLADMEVKVQAARHLVYQAAINKDLGKPYGVEAA 316 L T+ YV+ER FGR + +FQNT+F LA++ ++ R Q G+ G +AA Sbjct: 259 LALTLDYVRERRAFGRAVGEFQNTRFTLAEVRAQIDMGRAYFEQCVAKYRQGEMNGTDAA 318 Query: 317 MAKLFAAETAMEVTTKAVQLHGGYGYTRDYPVERMMRDAKITEIYEGTSEVQRMVISGKL 376 + KL +E +QL GGYGYTR+YP+ R DA++ +Y GTSE+ + VI+ L Sbjct: 319 ILKLQLSEMQCRTIDACLQLFGGYGYTREYPISRFYLDARVQTLYAGTSEIMKEVIARSL 378 Query: 377 L 377 L Sbjct: 379 L 379 Lambda K H 0.315 0.133 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 309 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 378 Length of database: 385 Length adjustment: 30 Effective length of query: 348 Effective length of database: 355 Effective search space: 123540 Effective search space used: 123540 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory