Align TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate WP_086509537.1 BZY95_RS08640 ABC transporter ATP-binding protein
Query= TCDB::Q9X271 (324 letters) >NCBI__GCF_002151265.1:WP_086509537.1 Length = 349 Score = 282 bits (721), Expect = 1e-80 Identities = 146/315 (46%), Positives = 207/315 (65%), Gaps = 1/315 (0%) Query: 4 LLNVNNLKVEFHRVEGIVKAVDGISYKLNKGESLGIVGESGSGKSVSVLSLLRLINRNGR 63 +L+V +L+VEF G + A+D +S+ + GE LG+VGESG+GKS++ +++RL+ G Sbjct: 14 VLSVRHLRVEFPTRHGTLVALDDVSFDIAPGEVLGVVGESGAGKSMTGNAVIRLLEPPGH 73 Query: 64 IVDGEAIFLGKDLLKLNKEELRNIRGKDISIIFQNPMTSLNPIIRVGIQVMEPIIWHRLM 123 I GE + G+ + L +E +RG+ I +IFQ+P+TSLNP+ VG Q++E I H M Sbjct: 74 IAAGEVLLSGQRIDDLPEERFVPLRGRHIGMIFQDPLTSLNPLFSVGDQLIETIRAHLPM 133 Query: 124 KNEEARERAIELLERVGIPESPKRFLNYPFQFSGGMRQRVMIAMALACHPKLLIADEPTT 183 EARE A++LL VGIP R +YP QFSGGMRQRV+IA+ALA P+ +IADEPTT Sbjct: 134 NEREAREEALKLLREVGIPAPENRIDSYPHQFSGGMRQRVVIALALAARPEFIIADEPTT 193 Query: 184 ALDVTIQAQIMELLQELKEEYGMSVIFITHDLSVATNFCDRIITMYAGKIVEEAPVEEIL 243 ALDV++QAQI+ LL+ L ++G +V+ +THD+ V DR+ MYAG+++E PV+E++ Sbjct: 194 ALDVSVQAQILALLKRLCADHGTAVMLVTHDMGVIAETADRVAVMYAGRLIEIGPVDEVI 253 Query: 244 KTPLHPYTKGLLNSTLEIGSRGKKLVPIPGNPPNPTKHPSGCKFHPRCSFAMEICQREEP 303 + P HPYTKGL+ S I R +L I G P PSGC F+PRC A + C+ E P Sbjct: 254 RHPQHPYTKGLMASIPGIAKRLDRLYQIEGAMPRLAAIPSGCAFNPRCPHAQQRCRDERP 313 Query: 304 PLVNISENHRVACHL 318 L+ + R AC L Sbjct: 314 DLMP-AGGSRAACWL 327 Lambda K H 0.320 0.139 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 293 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 349 Length adjustment: 28 Effective length of query: 296 Effective length of database: 321 Effective search space: 95016 Effective search space used: 95016 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory