Align Tricarboxylate transport protein TctC (characterized)
to candidate WP_086509567.1 BZY95_RS08755 tripartite tricarboxylate transporter substrate binding protein
Query= reanno::Dino:3609740 (326 letters) >NCBI__GCF_002151265.1:WP_086509567.1 Length = 333 Score = 203 bits (516), Expect = 5e-57 Identities = 114/320 (35%), Positives = 170/320 (53%), Gaps = 5/320 (1%) Query: 10 LIAAAAALAMTGGAHAEGEQMLESIHFLIPGGAGGGWDGTARGTGEALTKAGLVG-SASY 68 ++ AA + M+ A A+ +I F+ P GGGWD R T + + GL S Sbjct: 14 VLPLAAVVGMSSAAQADEWTPTRNIEFIAPANPGGGWDTLVRTTSRVIQEEGLAERSFGA 73 Query: 69 ENMSGGGGGKAIAYLIENANSSHGTLMVNSTPIVIRSLTGEISQSFRDLTLVAGTIGDYA 128 N+ GGGG A A + ++ + H L S PI++ L G T +A I DY+ Sbjct: 74 INVPGGGGAVAWAQIARDSGNPH-KLFATSPPIILVPLAGASRYDHTSFTPIARLITDYS 132 Query: 129 AIVVGKDSPINSMADLIAAYDADPNATAVGGGSVPGGMDHLVAAMVMEAAGKDALGVKYI 188 ++V DSP + LI A + +P + VGGGS PG MDH+ A + AAG +A V YI Sbjct: 133 IVLVRNDSPYEDLPSLIEAMEQNPQLS-VGGGSAPGSMDHISMAGLAAAAGLNASDVNYI 191 Query: 189 PYDAGGKAMAALLSGEIAALSTGFSEAI-DLAEAGEVKIIGVTAPERVA-AYDSAPTMVE 246 P+ GG+AM +L+ G + A+ TG EA L E +++ +GV+APER+ A PT E Sbjct: 192 PFSGGGEAMTSLMGGHVEAVITGAGEASGQLGENSQIRALGVSAPERLGGALAEVPTYQE 251 Query: 247 QGIDTTFVNWRGFFAAPGLPEEQLAAYQATLEKMYDTPEWEEVRARNGWVNIHNSGADFQ 306 Q ID TF WRG P +P E +A Y+ +M +T W++ R + GW++ + +F Sbjct: 252 QDIDYTFDIWRGVMGTPDMPAEAVAYYEDLFAQMLETDGWQQAREQLGWIDAYQDSEEFG 311 Query: 307 SFLEAQEAQIGDLMKKLGFL 326 +FL+ Q+ Q ++ LG L Sbjct: 312 AFLDEQKEQFSTILGDLGLL 331 Lambda K H 0.315 0.132 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 326 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 326 Length of database: 333 Length adjustment: 28 Effective length of query: 298 Effective length of database: 305 Effective search space: 90890 Effective search space used: 90890 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory