Align Probable TonB-dependent receptor, component of L-Histidine uptake porter, MetIQN (characterized)
to candidate WP_086509600.1 BZY95_RS08955 MetQ/NlpA family ABC transporter substrate-binding protein
Query= TCDB::Q9HT68 (260 letters) >NCBI__GCF_002151265.1:WP_086509600.1 Length = 271 Score = 196 bits (497), Expect = 6e-55 Identities = 106/259 (40%), Positives = 159/259 (61%), Gaps = 5/259 (1%) Query: 5 LAAFSAVAALGLT-AAQAAESLTVAATPVPHAEILNVVKPLLAKEGVDLKIK--EFTDYV 61 LA+ VA G A S+ V P +E++ V + A+E DL+++ EFTDYV Sbjct: 14 LASAILVAGCGNDDGATETRSIKVGTMSGPESEVMEVAVQI-ARERYDLEVEIIEFTDYV 72 Query: 62 QPNVQVSEKRLDANFFQHQPYLDEFNKAKGTDLVAVTGVHIEPLGAYSSKYKKLDELPSG 121 PN +++ LDAN FQH+PYL + +G DL + P+GAYS ++ ++ELP Sbjct: 73 SPNAALADGSLDANAFQHEPYLRSMIEDRGYDLAVAGYTFVYPIGAYSERHDSIEELPER 132 Query: 122 ATVVIPNDATNGGRALLLLDKAGVIKLKDNKSITATPKDIVDNPKNIKIRELEAATLPRV 181 A V +PND TNGGRA++L+ AG+I+L D +++ ATP ++V+NP ++ RE+EAA LPRV Sbjct: 133 AIVALPNDPTNGGRAMILMHNAGLIELDDPENLEATPINVVENPLGLRFREIEAAQLPRV 192 Query: 182 LTQVDMALINTNYALEAKLNPTKDALAIEGSDSPYVNILVARPDNKDSDAMQKLAKALHS 241 LT VD+A IN +A A L+ DAL EG++SPYVN++ R +++ + +Q+L A S Sbjct: 193 LTDVDLAFINNTFAQPAGLH-LDDALIQEGAESPYVNLIAVRAGDEEREEIQQLVSAYQS 251 Query: 242 AEIKQFIQEKYKGAVVPAF 260 E+ E + G VP + Sbjct: 252 EEVAAKAAELFDGGAVPGW 270 Lambda K H 0.314 0.131 0.354 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 179 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 271 Length adjustment: 25 Effective length of query: 235 Effective length of database: 246 Effective search space: 57810 Effective search space used: 57810 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory