Align ABC-type branched-chain amino acid transport system, permease component protein (characterized, see rationale)
to candidate WP_086509603.1 BZY95_RS08775 urea ABC transporter permease subunit UrtB
Query= uniprot:D8IUY4 (309 letters) >NCBI__GCF_002151265.1:WP_086509603.1 Length = 524 Score = 137 bits (345), Expect = 6e-37 Identities = 90/298 (30%), Positives = 162/298 (54%), Gaps = 21/298 (7%) Query: 11 GLVLGSMYALIALGYTMVYGVLNLINFAHGDILMVGAMVGLSLLKVVQQVAPGLPGIVQL 70 GL LGS+ L A+G + +GV+ +IN AHG+++M+GA ++ QQ+ PG PG+ L Sbjct: 238 GLSLGSVLVLAAIGLAITFGVMGVINMAHGELIMLGAYTTWAM----QQLLPGQPGLA-L 292 Query: 71 VIAIVGAIPVCIVVSLLIERIAYRPLRNAPRLAPLITAIGVSILLQTLAMMIWGRSPLPF 130 ++AI V + + IER + L+ P L L+ G+S++LQ L G SPL Sbjct: 293 ILAIPAGFLVAALAGIAIERGVIQFLKGRP-LETLLATFGISLILQQLVRT--GISPLNR 349 Query: 131 PQVMP---SDPVHIAGAL-ISPTQIMLLALAVLAMVGLVLIVEKTKMGRAMRATAENPRI 186 + P S + + AL ++ ++ +L A++ L+LI+ +T++G +RA +N + Sbjct: 350 TVITPEWMSGSIAVNDALSLTLNRMYVLGFALVVFAVLMLIMRRTRLGLEVRAVTQNRAM 409 Query: 187 AGLMGVDANKVIVVTFAIGAGLAAIAGVMWAANYSTAQFAMGFVPGLKAFSAAVLGGIGN 246 A MG+ A +V ++TFA+G+G+A +AGV + + +G + +F V GG+GN Sbjct: 410 ARSMGIRATRVDIMTFALGSGVAGLAGVA-LSQLTNVGPNLGQNYIIDSFMVVVFGGVGN 468 Query: 247 IYGAMLGGILLGLIESLGAGYIGDLTGNFLGSNYQDIFAFIVLIIVLTLRPSGIMGER 304 ++G ++ G+ LG+I + + G + I + +I+ + RP G+ ++ Sbjct: 469 LWGTLVAGLSLGVINQVLEPWAGAVMAK--------IIVLVFIILFIQKRPRGLFPQK 518 Lambda K H 0.328 0.144 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 354 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 524 Length adjustment: 31 Effective length of query: 278 Effective length of database: 493 Effective search space: 137054 Effective search space used: 137054 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory