Align isobutanoate/2-methylbutanoate--CoA ligase (EC 6.2.1.1) (characterized)
to candidate WP_086509632.1 BZY95_RS09125 AMP-binding protein
Query= metacyc::MONOMER-20125 (556 letters) >NCBI__GCF_002151265.1:WP_086509632.1 Length = 567 Score = 184 bits (466), Expect = 1e-50 Identities = 156/535 (29%), Positives = 239/535 (44%), Gaps = 37/535 (6%) Query: 28 GDCTSVVYDAVSYTWSQTHRRCLCLASSIASLGIENGHVVSVLAPNVPQMYELHFAVPMA 87 G+ ++ + YTW + + A ++ +LG++ G V + +PN + FA Sbjct: 42 GEALLSLHQGLRYTWKELQQAVNQAARAMLALGVKKGDRVGIWSPNCAEWSITQFATAKI 101 Query: 88 GAILNAVNLRLDARTISILLHHSESKLIFVD--HLSRDLILEAIALFPK----------Q 135 GAIL +N + L S + + + + D + L P+ Sbjct: 102 GAILVNINPSYRTHELEYALKQSGTSTLILQGKFKTSDYVATLAELAPELREGAPSTFSA 161 Query: 136 APVPRL--VFMADESESGNSSELGKEFFCSYKDLIDRGDPDFKWVMPKSEWDPMILNYTS 193 A +P L V D + + ++ + D + + E P+ + YTS Sbjct: 162 AKLPELKRVVCLDADRALTGMFSWQSMLAHADEVSEEHLADVQATLQFDE--PINIQYTS 219 Query: 194 GTTSSPKGVVHCHRGIFIMTVDSLIDWGVPKQPVYLWTLPMFHANGWSYP-WGMAAVGGT 252 GTT +PKG H I G ++ + +P++H G G G T Sbjct: 220 GTTGAPKGATLSHHNILNNGFFVARTMGFSEKDRLVIPVPLYHCFGMVMGNLGCVTHGAT 279 Query: 253 NICLRK-FDSEIIYDMIKRHGVTHMCGAPVVLNMLSNAP--GSEPLKTTVQIMTAGAPPP 309 I FD E + T + G P + P L T + AG+ P Sbjct: 280 MIYPGDGFDPEATLKAVSDEKATALYGVPTMFIAELEHPDFAQYDLSTLRTGIMAGSICP 339 Query: 310 SAVLFRTESLGFA--VSHGYGLTETAGLVVSCAWKKEWNHLPATERARLKSRQGVGTVM- 366 V+ + V+ YG+TET+ VS K + P +R VGT+ Sbjct: 340 IEVMRKVIDKMHMEDVTICYGMTETSP--VSTQTKTD---APLEKRVTT-----VGTIHP 389 Query: 367 QTKIDVVDPVTGAAVKRDGSTLGEVVLRGGSVMLGYLKDPEGTAKSMTADGWFYTGDVGV 426 ++ +V P TGA V R G T GE+ RG SVMLGY + E TAKS+ + GW +TGD+ Sbjct: 390 HLEVKLVSPETGAVVPR-GET-GELCTRGYSVMLGYWNNEEATAKSIDSAGWMHTGDLAT 447 Query: 427 MHPDGYLEIKDRSKDVIISGGENLSSVEVESILYSHPDILEAAVVARPDEFWGETPCAFV 486 M +GY+ I R KD+II GGEN+ E+E LY+HP I + V+ PDE +GE A+V Sbjct: 448 MDEEGYIAIVGRIKDMIIRGGENIYPREIEDFLYTHPAISDVQVIGVPDEKYGEEVMAWV 507 Query: 487 SLKKGLTKKPTEKEIVEYCRSKLPRYMVPKTVVFKEELPKTSTGKVQKFILRDMA 541 L +G +K E+ E+C+ K+ Y +P+ V F +E P T TGK+QKF +R+ A Sbjct: 508 KLAEG--QKLNADELKEFCKGKIAHYKIPRYVKFVDEFPMTVTGKIQKFKMREEA 560 Lambda K H 0.319 0.135 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 748 Number of extensions: 37 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 556 Length of database: 567 Length adjustment: 36 Effective length of query: 520 Effective length of database: 531 Effective search space: 276120 Effective search space used: 276120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory