Align Formiminoglutamase (EC 3.5.3.8) (characterized)
to candidate WP_086509680.1 BZY95_RS09390 formimidoylglutamase
Query= reanno::Koxy:BWI76_RS08725 (318 letters) >NCBI__GCF_002151265.1:WP_086509680.1 Length = 319 Score = 230 bits (587), Expect = 3e-65 Identities = 142/305 (46%), Positives = 181/305 (59%), Gaps = 14/305 (4%) Query: 12 WQGRDDSAEAANALRLFQTIVRAERFEPEMLAGDIALLGFACDEGVRRNKGRTGAERGPE 71 W GR+D ++LR Q I P+ G AL+GFA D GV RN+GR GA GP Sbjct: 14 WAGREDPEP--DSLRWHQVITPVR---PDSAPG-AALVGFASDAGVARNQGRVGAAEGPR 67 Query: 72 TLRRALANMASHDGHDRCVDMGTIHV-ADDALEAAQQALREAVTACQRAGKRTLVLGGGH 130 +RRALA +A H D G + +D LEAAQQ L + + + G + LVLGGGH Sbjct: 68 AIRRALAPLAWHRSAP-VFDAGDVSCHGNDDLEAAQQRLADRIASLLARGHQPLVLGGGH 126 Query: 131 ETAFGHGAGVLDAFPGE-----EVGIINLDAHLDLRIADRA-SSGTPFRQLALACEAQRR 184 E AFG +G+ F E +GIINLDAH DLR SSGTPF Q+A C A+ Sbjct: 127 EVAFGSWSGLARHFEAEGEAHPRIGIINLDAHFDLRDPTHVRSSGTPFAQIAAECHARDW 186 Query: 185 AFHYACIGVSRAANTQALLDEAARRGVTIIEDLDVLNAFEARAIPELARNIARYDRLYLT 244 F YAC+GVSRA+NT+AL A V + ED ++ + +L R +AR D LYL+ Sbjct: 187 PFRYACLGVSRASNTRALFTRARELNVLVREDHEIDALRLDAIVRDLQRFMARCDHLYLS 246 Query: 245 IDLDVLPAREMPAVSAPAALGIPLATLLRIVEPLCRSGKLQAVDLVEFNPQYDIDSQGAR 304 IDLDVLPA E P VSAPAA G+PLA + ++E + SGKL+ D+ E NP +DID + A+ Sbjct: 247 IDLDVLPAAEAPGVSAPAARGVPLALIEPLLEAVRDSGKLRLADVAELNPSFDIDGRTAK 306 Query: 305 AAARL 309 AAARL Sbjct: 307 AAARL 311 Lambda K H 0.322 0.135 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 293 Number of extensions: 20 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 319 Length adjustment: 27 Effective length of query: 291 Effective length of database: 292 Effective search space: 84972 Effective search space used: 84972 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate WP_086509680.1 BZY95_RS09390 (formimidoylglutamase)
to HMM TIGR01227 (hutG: formimidoylglutamase (EC 3.5.3.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01227.hmm # target sequence database: /tmp/gapView.22707.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01227 [M=307] Accession: TIGR01227 Description: hutG: formimidoylglutamase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-101 325.8 0.0 1.6e-101 325.5 0.0 1.0 1 lcl|NCBI__GCF_002151265.1:WP_086509680.1 BZY95_RS09390 formimidoylglutama Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_002151265.1:WP_086509680.1 BZY95_RS09390 formimidoylglutamase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 325.5 0.0 1.6e-101 1.6e-101 3 304 .. 16 314 .. 14 316 .. 0.95 Alignments for each domain: == domain 1 score: 325.5 bits; conditional E-value: 1.6e-101 TIGR01227 3 grldleeaskkrrdeqvakvvdlveledaqdekgvaliGvaldkgvirnkGrtGAkeaPsairqalanl 71 gr d+e +++ r++qv+++v + + +g+al+G+a+d+gv+rn+Gr+GA e+P air+ala l lcl|NCBI__GCF_002151265.1:WP_086509680.1 16 GREDPE--PDSLRWHQVITPVRP------DSAPGAALVGFASDAGVARNQGRVGAAEGPRAIRRALAPL 76 555554..56899******9999......7789************************************ PP TIGR01227 72 gdlvasealyDlGdivleg.ddlvdaqkevaqavaelladarvvvllGGdneiayatikalaqa..akg 137 +++ s ++ D+Gd+ ++g ddl++aq+ +a ++a+lla ++++++lGG++e+a+ + +la++ a+g lcl|NCBI__GCF_002151265.1:WP_086509680.1 77 -AWHRSAPVFDAGDVSCHGnDDLEAAQQRLADRIASLLARGHQPLVLGGGHEVAFGSWSGLARHfeAEG 144 .****************96378******************************************76555 PP TIGR01227 138 ek..riGvinfDAHfDlRavederptsGTpfrqlldeeqaed..fhlivlGirrfsntqalfdyakkkg 202 e riG+in+DAHfDlR + +sGTpf q++ e+ a d f +++lG++r+snt alf +a++++ lcl|NCBI__GCF_002151265.1:WP_086509680.1 145 EAhpRIGIINLDAHFDLRDPT-HVRSSGTPFAQIAAECHARDwpFRYACLGVSRASNTRALFTRARELN 212 5589***************99.67799****************************************** PP TIGR01227 203 vryvtddalaelsletikdileefldevDfiyltvdlDVldaasAPGvsApaagGleleellelvkria 271 v + +d+++ +l l+ i l++f+ +D++yl++dlDVl+aa APGvsApaa+G+ l +++l++++ lcl|NCBI__GCF_002151265.1:WP_086509680.1 213 VLVREDHEIDALRLDAIVRDLQRFMARCDHLYLSIDLDVLPAAEAPGVSAPAARGVPLALIEPLLEAVR 281 ********************************************************************* PP TIGR01227 272 asdkvrgveivEvnPtlDaddrTarlaArlvah 304 s+k+r+++++E+nP++D+d+rTa++aArl++ lcl|NCBI__GCF_002151265.1:WP_086509680.1 282 DSGKLRLADVAELNPSFDIDGRTAKAAARLIHR 314 *******************************96 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (307 nodes) Target sequences: 1 (319 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 7.88 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory