Align Arginase; EC 3.5.3.1 (characterized)
to candidate WP_086509701.1 BZY95_RS09505 agmatinase
Query= SwissProt::P00812 (333 letters) >NCBI__GCF_002151265.1:WP_086509701.1 Length = 316 Score = 76.3 bits (186), Expect = 1e-18 Identities = 62/197 (31%), Positives = 87/197 (44%), Gaps = 36/197 (18%) Query: 116 PLTLGGDHSIAIGTVSAVLDKYPDAGLLWIDAHADINTIESTPSGNLHGCPVSFLMGLNK 175 PLTLGGDH I + + A+ K+ GL+ +DAHAD+N HG P Sbjct: 118 PLTLGGDHVITLPILRAIAKKHGPVGLIHVDAHADVNE-HMFGEAIAHGTPFRRAQE--- 173 Query: 176 DVPHCPESLKWVPGNLSPKKIAYIGLRDVDAGEKKILKDLGIAAFSMYHVDKYGINAVI- 234 G L+ K+ IGLR G AA + G V Sbjct: 174 ------------EGLLAHGKVVQIGLRGT-----------GYAAEDFDWCRQQGFRVVTA 210 Query: 235 -EMAMKAVHP------ETNGEGPIMCSYDVDGVDPLYIPATGTPVRGGLTLREGLFLVER 287 E +++ P E G+ P+ ++D+DG+DP P TGT GGLT +GL +V R Sbjct: 211 EECWYRSLAPLMAEVREQMGDTPVYVTFDIDGLDPSVAPGTGTVEMGGLTSAQGLEIV-R 269 Query: 288 LAESGNLIALDVVECNP 304 A N++ D+VE +P Sbjct: 270 GAAGLNIVGGDLVEVSP 286 Lambda K H 0.316 0.137 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 312 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 333 Length of database: 316 Length adjustment: 28 Effective length of query: 305 Effective length of database: 288 Effective search space: 87840 Effective search space used: 87840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory