Align BilEA aka OpuBA protein, component of A proline/glycine betaine uptake system. Also reported to be a bile exclusion system that exports oxgall and other bile compounds, BilEA/EB or OpuBA/BB (required for normal virulence) (characterized)
to candidate WP_086509734.1 BZY95_RS09705 ABC transporter ATP-binding protein
Query= TCDB::Q93A35 (328 letters) >NCBI__GCF_002151265.1:WP_086509734.1 Length = 313 Score = 238 bits (606), Expect = 2e-67 Identities = 118/238 (49%), Positives = 161/238 (67%), Gaps = 2/238 (0%) Query: 1 MIRFDNVSKKYSDDKTAAVNNVTLDIKDGEFFVFIGPSGCGKTTTLKMINRLIPLTTGTI 60 MI +V+K++ D+ AV+ ++L ++ GE +G SGCGK+TTL+MINRLI G I Sbjct: 1 MIELFDVTKRFGDE--TAVDGISLRVEKGELCALVGTSGCGKSTTLRMINRLIEHDGGEI 58 Query: 61 YINEKRISDYDIHELRWDIGYVLQQIALFPHMTIEENIAIVPELKKWSKEKIHDRITELL 120 +++ + + +D LR IGYV+Q LFPH T+ NI +VP L KW K K+ DR+ EL+ Sbjct: 59 HLDGQPVRSFDEVALRRRIGYVIQSTGLFPHWTVARNIGLVPRLLKWPKGKVRDRVEELM 118 Query: 121 DSVGLDPESYRHRKPAELSGGEQQRVGVVRALAADPGIILMDEPFSALDPISRQRLQQDI 180 +GL + + P +LSGG+ QRVGV RALAADP I+LMDEPF ALDPI+R LQ ++ Sbjct: 119 QLLGLPVAEFADKYPRQLSGGQAQRVGVARALAADPDILLMDEPFGALDPITRATLQDEL 178 Query: 181 SALQKKIKKTIVFVTHDMQEALALGDRICVMQGGEIVQVATPQEIMKNPENDFVKDFL 238 LQ ++ KT+VFVTHDM EALAL DR+ VM G IVQ +P E+++ P N FV+ L Sbjct: 179 RVLQARLHKTVVFVTHDMDEALALADRLVVMHQGRIVQQGSPVELLREPANPFVESLL 236 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 261 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 313 Length adjustment: 28 Effective length of query: 300 Effective length of database: 285 Effective search space: 85500 Effective search space used: 85500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory