Align Cyclohex-1-ene-1-carbonyl-CoA dehydrogenase; Ch1CoA; EC 1.3.8.10 (characterized)
to candidate WP_086509764.1 BZY95_RS09860 acyl-CoA dehydrogenase
Query= SwissProt::Q2LQN9 (414 letters) >NCBI__GCF_002151265.1:WP_086509764.1 Length = 383 Score = 255 bits (652), Expect = 1e-72 Identities = 149/381 (39%), Positives = 219/381 (57%), Gaps = 8/381 (2%) Query: 37 LTEEQKLLMEMVRNLA--VRE-IAPRAIEIDENHSFPVHARDLFADLGLLSPLVPVEYGG 93 + + +LL +++ ++ VRE + P + E + P + ++GL +P EYGG Sbjct: 1 MIRDPELLAQLIDTISRFVRERLIPNEARLAEEDAVPAELLEEMKEMGLFGLSIPEEYGG 60 Query: 94 TGMDITTFAMVLEEIGKVC-ASTALMLLAQADGMLSIILDGSPALKEKYLPRFGEKSTLM 152 G+ + A+V EIGK A ++ G I++DG+P K KY+PR L+ Sbjct: 61 LGLTMEEEALVAMEIGKTSPAFRSIFGTNNGIGAQGILIDGTPEQKAKYVPRLAT-GELL 119 Query: 153 TAFAATEPGAGSDLLAMKTRAVKKGDKYVINGQKCFITNGSVADILTVWAYTDP-SKGAK 211 ++F TEP AGSD +++T AV+ GD YV+NG K FITNG AD+ TV A TDP +KGA Sbjct: 120 SSFCLTEPDAGSDAASLRTTAVRDGDHYVLNGTKRFITNGPEADVFTVMARTDPGNKGAG 179 Query: 212 GMSTFVVERGTPGLIYGHNEKKMGMRGCPNSELFFEDLEVPAENLV-GEEGKGFAYLMGA 270 G++ F+VE TPGL G + KMG +G ++ FED VPAEN++ G EGKGF M Sbjct: 180 GITAFIVEGDTPGLKRGPADSKMGQKGAHTCDIIFEDCRVPAENIIGGVEGKGFKTAMKV 239 Query: 271 LSINRVFCASQAVGIAQGALERAMQHTREREQFGKPIAHLTPIQFMIADMATEVEAARLL 330 L R+ ++ VG+A+ +E ++ + ER+QFG P+A +Q M+AD TE A R + Sbjct: 240 LDRGRLHISAVCVGVAERLVEESLNYAIERKQFGVPLAEHQLVQAMLADSKTEAYAGRTM 299 Query: 331 VRKATTLLDAKDKRGPLIGGMAKTFASDTAMKVTTDAVQVMGGSGYMQEYQVERMMREAK 390 V A DA + L K F ++ +V AVQV GG+GYM EY VER R+ + Sbjct: 300 VLDAARRKDAGENASTL-ASCCKLFCAEMVGRVADRAVQVHGGAGYMAEYAVERFYRDVR 358 Query: 391 LTQIYTGTNQITRMVTGRSLL 411 L +IY GT QI ++V R+++ Sbjct: 359 LFRIYEGTTQIQQVVIARNMV 379 Lambda K H 0.318 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 394 Number of extensions: 21 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 414 Length of database: 383 Length adjustment: 31 Effective length of query: 383 Effective length of database: 352 Effective search space: 134816 Effective search space used: 134816 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory