Align Isovaleryl-CoA dehydrogenase (EC 1.3.8.4) (characterized)
to candidate WP_086509764.1 BZY95_RS09860 acyl-CoA dehydrogenase family protein
Query= reanno::Phaeo:GFF1011 (386 letters) >NCBI__GCF_002151265.1:WP_086509764.1 Length = 383 Score = 268 bits (684), Expect = 2e-76 Identities = 137/372 (36%), Positives = 222/372 (59%), Gaps = 2/372 (0%) Query: 17 LRDMVHRWAQERVRPMAQEIDQKNEFPAELWQEMGELGLLGITVPEEFGGAGMSYLAHTV 76 L D + R+ +ER+ P + +++ PAEL +EM E+GL G+++PEE+GG G++ + Sbjct: 11 LIDTISRFVRERLIPNEARLAEEDAVPAELLEEMKEMGLFGLSIPEEYGGLGLTMEEEAL 70 Query: 77 AVEEIARASASVSLSYGAHSNLCVNQIKLNGNAEQKAKYLPRLVSGEHVGALAMSEAGAG 136 EI + S + +G ++ + I ++G EQKAKY+PRL +GE + + ++E AG Sbjct: 71 VAMEIGKTSPAFRSIFGTNNGIGAQGILIDGTPEQKAKYVPRLATGELLSSFCLTEPDAG 130 Query: 137 SDVVSMSLRAEKRNDHYRLNGNKYWITNGPDADTLVVYAKTDP-DAGSKGMTAFLIEKEF 195 SD S+ A + DHY LNG K +ITNGP+AD V A+TDP + G+ G+TAF++E + Sbjct: 131 SDAASLRTTAVRDGDHYVLNGTKRFITNGPEADVFTVMARTDPGNKGAGGITAFIVEGDT 190 Query: 196 KGFSTSQHFDKLGMRGSNTAELVFEDVEVPFENVL-GEEGKGVRVLMSGLDYERVVLAGI 254 G K+G +G++T +++FED VP EN++ G EGKG + M LD R+ ++ + Sbjct: 191 PGLKRGPADSKMGQKGAHTCDIIFEDCRVPAENIIGGVEGKGFKTAMKVLDRGRLHISAV 250 Query: 255 GTGIMAACMDEMMPYMKERKQFGQPIGNFQLMQGKIADMYTAMNTARAYVYEVAKACDKG 314 G+ ++E + Y ERKQFG P+ QL+Q +AD T R V + A+ D G Sbjct: 251 CVGVAERLVEESLNYAIERKQFGVPLAEHQLVQAMLADSKTEAYAGRTMVLDAARRKDAG 310 Query: 315 TVTRQDAAACCLYASEVAMTQAHQAVQAFGGAGYLSDNPVGRIFRDAKLMEIGAGTSEIR 374 A+ C L+ +E+ A +AVQ GGAGY+++ V R +RD +L I GT++I+ Sbjct: 311 ENASTLASCCKLFCAEMVGRVADRAVQVHGGAGYMAEYAVERFYRDVRLFRIYEGTTQIQ 370 Query: 375 RMLIGRELMSQM 386 +++I R ++ ++ Sbjct: 371 QVVIARNMVREV 382 Lambda K H 0.318 0.132 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 384 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 383 Length adjustment: 30 Effective length of query: 356 Effective length of database: 353 Effective search space: 125668 Effective search space used: 125668 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory