Align 8-amino-7-oxononanoate synthase/2-amino-3-ketobutyrate coenzyme A ligase; AONS/AKB ligase; 7-keto-8-amino-pelargonic acid synthase; 7-KAP synthase; KAPA synthase; 8-amino-7-ketopelargonate synthase; Alpha-oxoamine synthase; Glycine acetyltransferase; EC 2.3.1.29; EC 2.3.1.47 (characterized)
to candidate WP_086509807.1 BZY95_RS10090 8-amino-7-oxononanoate synthase
Query= SwissProt::Q5SHZ8 (395 letters) >NCBI__GCF_002151265.1:WP_086509807.1 Length = 384 Score = 238 bits (607), Expect = 2e-67 Identities = 137/346 (39%), Positives = 195/346 (56%), Gaps = 3/346 (0%) Query: 43 VVNLASNNYLGFANHPYLKEKARQYLEKWGAGSGAVRTIAGTFTYHVELEEALARFKGTE 102 +V+ A N+YLG + P L E +++GAG+GA ++G H LE LA G Sbjct: 35 LVDFAGNDYLGLKDDPRLAEAQAAAAKRFGAGAGASHLVSGHLEVHEALERRLAELVGRP 94 Query: 103 SALVLQSGFTANQGVLGALLKEGDVVFSDELNHASIIDGLRLTKATRLVFRHADVAHLEE 162 AL+ +G+ AN G L AL ++F D LNHAS++DG L A F H D LE Sbjct: 95 RALLFSTGYMANLGTLQALCDSNTLIFQDRLNHASLLDGAALAGARSRRFHHRDFNDLER 154 Query: 163 LLKAHDTDGLKLIVTDGVFSMDGDIAPLDKIVPLAKKYKAVVYVDDAHGSGVLGEKGKGT 222 LL + KL+V+DGVFSMDGD+A + + ++ ++ A + +DDAHG GVLG G G Sbjct: 155 LLGRAPAEAAKLVVSDGVFSMDGDVADVGGLAAVSARHDAWLMIDDAHGIGVLGAHGDGC 214 Query: 223 V-HHFGFHQDPDVVQVATLSKAWAGIGGYAAGARELKDLLINKARPFLFSTSHPPAVVGA 281 V H G + P V V TL KA G + AG+ L + LI AR ++++T+ PP V A Sbjct: 215 VGHAHGVERVP--VLVGTLGKALGTGGAFVAGSDALIEHLIQFARAYVYTTAQPPGVAAA 272 Query: 282 LLGALELIEKEPERVERLWENTRYFKRELARLGYDTLGSQTPITPVLFGEAPLAFEASRL 341 L AL+++ EPER ++L +N YF+RE A L S TPI P++ GE + Sbjct: 273 SLAALDVLAAEPERRQQLRDNIHYFRREAALLDLPLGDSFTPIQPLILGEGRQVMHWAAR 332 Query: 342 LLEEGVFAVGIGFPTVPRGKARIRNIVTAAHTKEMLDKALEAYEKV 387 L E + I PTVP G+AR+R + A+H++E LD+ LEA ++ Sbjct: 333 LREADLLVGAIRPPTVPNGEARLRITLRASHSRESLDRLLEALARL 378 Lambda K H 0.319 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 354 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 384 Length adjustment: 30 Effective length of query: 365 Effective length of database: 354 Effective search space: 129210 Effective search space used: 129210 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory