Align protein-Npi-phosphohistidine-D-fructose phosphotransferase (subunit 1/2) (EC 2.7.1.202) (characterized)
to candidate WP_086509854.1 BZY95_RS10365 PTS IIA-like nitrogen-regulatory protein PtsN
Query= BRENDA::Q8DWE6 (150 letters) >NCBI__GCF_002151265.1:WP_086509854.1 Length = 156 Score = 74.3 bits (181), Expect = 8e-19 Identities = 41/132 (31%), Positives = 75/132 (56%), Gaps = 1/132 (0%) Query: 15 SQDEVFHYLATLVVDNGYANNTESVVQALKLRESEGTTGMMEGFAIPHAKDKSIVKPSIA 74 S+ V + +T + N + +++ V L RE G+TG+ G AIPHA+ P A Sbjct: 20 SKKRVLEFFSTFIAQNTPSLDSQEVFGRLIGRERLGSTGIGNGVAIPHARSPHCHSPVAA 79 Query: 75 ILKLKTGVEWHSMDGQLINNVIALFIPEKEAGTTHLKVLSQIARLLVNKTFKEKIKEADT 134 LKL +++ ++DG+ ++ V L +PE EA THL +LSQ+A ++ + + ++++ ++ Sbjct: 80 FLKLAEPIDFDAIDGEPVDLVFVLLVPE-EADDTHLSLLSQVASVMNDAETRSQLRKCES 138 Query: 135 ILELKELLTEKL 146 EL E L + + Sbjct: 139 QRELHERLIDAI 150 Lambda K H 0.315 0.133 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 53 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 150 Length of database: 156 Length adjustment: 17 Effective length of query: 133 Effective length of database: 139 Effective search space: 18487 Effective search space used: 18487 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory