GapMind for catabolism of small carbon sources

 

Alignments for a candidate for fruD in Halomonas desiderata SP1

Align protein-Npi-phosphohistidine-D-fructose phosphotransferase (subunit 1/2) (EC 2.7.1.202) (characterized)
to candidate WP_086509854.1 BZY95_RS10365 PTS IIA-like nitrogen-regulatory protein PtsN

Query= BRENDA::Q8DWE6
         (150 letters)



>NCBI__GCF_002151265.1:WP_086509854.1
          Length = 156

 Score = 74.3 bits (181), Expect = 8e-19
 Identities = 41/132 (31%), Positives = 75/132 (56%), Gaps = 1/132 (0%)

Query: 15  SQDEVFHYLATLVVDNGYANNTESVVQALKLRESEGTTGMMEGFAIPHAKDKSIVKPSIA 74
           S+  V  + +T +  N  + +++ V   L  RE  G+TG+  G AIPHA+      P  A
Sbjct: 20  SKKRVLEFFSTFIAQNTPSLDSQEVFGRLIGRERLGSTGIGNGVAIPHARSPHCHSPVAA 79

Query: 75  ILKLKTGVEWHSMDGQLINNVIALFIPEKEAGTTHLKVLSQIARLLVNKTFKEKIKEADT 134
            LKL   +++ ++DG+ ++ V  L +PE EA  THL +LSQ+A ++ +   + ++++ ++
Sbjct: 80  FLKLAEPIDFDAIDGEPVDLVFVLLVPE-EADDTHLSLLSQVASVMNDAETRSQLRKCES 138

Query: 135 ILELKELLTEKL 146
             EL E L + +
Sbjct: 139 QRELHERLIDAI 150


Lambda     K      H
   0.315    0.133    0.358 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 53
Number of extensions: 3
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 150
Length of database: 156
Length adjustment: 17
Effective length of query: 133
Effective length of database: 139
Effective search space:    18487
Effective search space used:    18487
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 43 (21.2 bits)

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory