Align Maltose-transporting ATPase (EC 3.6.3.19) (characterized)
to candidate WP_086510094.1 BZY95_RS11665 sugar ABC transporter permease
Query= reanno::Koxy:BWI76_RS01825 (514 letters) >NCBI__GCF_002151265.1:WP_086510094.1 Length = 325 Score = 115 bits (288), Expect = 2e-30 Identities = 79/259 (30%), Positives = 135/259 (52%), Gaps = 24/259 (9%) Query: 256 TVTIGWDNFTRVFQDEG-----IQKPFFAIFVW-TVVFSVLTVILTVAVGMVLACLVQWE 309 T+ IG +N+ + D+G + P + VW TV FSV++V L V G+++A ++ E Sbjct: 71 TLFIGLENY--LVYDDGRWFGVLADPIWWRAVWNTVYFSVVSVSLEVVFGVIVALVLNAE 128 Query: 310 ALKGKAIYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGIKP--AWFSDPTT 367 KG+ + R +++P+A+P+ +S ++ + N FG IN +L AL I AW +D Sbjct: 129 -FKGRTLVRAAVLIPWAIPTIVSAQMWAWMLNDQFGIINHLLMALGIIASPIAWTADANY 187 Query: 368 ARTMIIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGATPFQNFFKITLPLLIKPLT 427 + +I+V+ W P++ +L + L+ +P D YEA+ +DG P + FF++TLPL+ L Sbjct: 188 SMWAVIMVDVWKTTPFVALLVLAALQMLPKDCYEAAEVDGIHPVKVFFRVTLPLITPALM 247 Query: 428 PLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVSYTYRIAFEGGGGQDFGLA 487 +I F +I +LT+ + + A LV + QD G Sbjct: 248 VAVIFRLLDALRVFDVIYVLTSNSTSTMSMSIYA--RQQLVEF-----------QDVGYG 294 Query: 488 AAIATLIFLLVGLLAIVNL 506 +A +TL+FL++ L I L Sbjct: 295 SAASTLLFLIIALATIAYL 313 Lambda K H 0.325 0.140 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 358 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 514 Length of database: 325 Length adjustment: 31 Effective length of query: 483 Effective length of database: 294 Effective search space: 142002 Effective search space used: 142002 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory