Align Binding-protein-dependent transport systems inner membrane component (characterized, see rationale)
to candidate WP_086510094.1 BZY95_RS11665 sugar ABC transporter permease
Query= uniprot:C8WUR0 (321 letters) >NCBI__GCF_002151265.1:WP_086510094.1 Length = 325 Score = 139 bits (350), Expect = 9e-38 Identities = 97/301 (32%), Positives = 160/301 (53%), Gaps = 19/301 (6%) Query: 9 RSHGRERAKRRVDWVAYGYLSPALVTICVLSILPIFYTIYISFTNFNQMHFLSYQFVGLK 68 RS R + R W+ +L+P LVT+ +++ P+ T Y SFT+ + + F+GL+ Sbjct: 21 RSTKVRRQRVRAAWL---FLAPMLVTLAMVAGWPLLRTFYFSFTDASLSDMSNTLFIGLE 77 Query: 69 NYEELLNPH--DPLSNLFLPTFIWTLVY-ALCTTALAYLVGLFLAVLLNNKHMRERTLYR 125 NY + L++ +W VY ++ + +L + G+ +A++LN + + RTL R Sbjct: 78 NYLVYDDGRWFGVLADPIWWRAVWNTVYFSVVSVSLEVVFGVIVALVLNAE-FKGRTLVR 136 Query: 126 TLLIVPWAVPNLISMLAWQGLLNDQYGQINALLH--GVFGLPRIPWLTSALWARIAVIMV 183 +++PWA+P ++S W +LNDQ+G IN LL G+ P I W A ++ AVIMV Sbjct: 137 AAVLIPWAIPTIVSAQMWAWMLNDQFGIINHLLMALGIIASP-IAWTADANYSMWAVIMV 195 Query: 184 NVWAGFPYMMTVCLGALQSIPTDQYEAAEIDGANWWQVFRYVTMPSVWRISLPLLIPSFS 243 +VW P++ + L ALQ +P D YEAAE+DG + +VF VT+P + + +I Sbjct: 196 DVWKTTPFVALLVLAALQMLPKDCYEAAEVDGIHPVKVFFRVTLPLITPALMVAVIFRLL 255 Query: 244 YNFNNFNASYLLTGGGPPNSNNPFLGQTDILATAAYKMTLTFNRYDLGATISVLLFILVA 303 F+ Y+LT NS + T ++ A + + F G+ S LLF+++A Sbjct: 256 DALRVFDVIYVLTS----NSTS-----TMSMSIYARQQLVEFQDVGYGSAASTLLFLIIA 306 Query: 304 L 304 L Sbjct: 307 L 307 Lambda K H 0.327 0.140 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 325 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 325 Length adjustment: 28 Effective length of query: 293 Effective length of database: 297 Effective search space: 87021 Effective search space used: 87021 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory