Align ABC transporter for D-Trehalose, permease component 1 (characterized)
to candidate WP_086510094.1 BZY95_RS11665 sugar ABC transporter permease
Query= reanno::Smeli:SM_b20326 (328 letters) >NCBI__GCF_002151265.1:WP_086510094.1 Length = 325 Score = 397 bits (1021), Expect = e-115 Identities = 195/304 (64%), Positives = 245/304 (80%), Gaps = 5/304 (1%) Query: 23 LQAQRVRSAWLFLAPTFLVLALVAGWPLIRTIYFSFTNASLTNLSGAEFVGFANYLSWIT 82 ++ QRVR+AWLFLAP + LA+VAGWPL+RT YFSFT+ASL+++S F+G NYL + Sbjct: 25 VRRQRVRAAWLFLAPMLVTLAMVAGWPLLRTFYFSFTDASLSDMSNTLFIGLENYLVY-- 82 Query: 83 LKSGRTIYRGLLADPAWWNAVWNTLKFTVLSVSIETALGLIVALVLNAQFPGRGLVRAAI 142 GR + G+LADP WW AVWNT+ F+V+SVS+E G+IVALVLNA+F GR LVRAA+ Sbjct: 83 -DDGR--WFGVLADPIWWRAVWNTVYFSVVSVSLEVVFGVIVALVLNAEFKGRTLVRAAV 139 Query: 143 LIPWAIPTIVSAKMWAWMLNDQFGILNDMLIGLGLIGEKIAWTASPDTAMIAELIVDVWK 202 LIPWAIPTIVSA+MWAWMLNDQFGI+N +L+ LG+I IAWTA + +M A ++VDVWK Sbjct: 140 LIPWAIPTIVSAQMWAWMLNDQFGIINHLLMALGIIASPIAWTADANYSMWAVIMVDVWK 199 Query: 203 TTPFMALLILAGLQMVPGDIYEAAKIDGVHPVRVFWRVTLPLIRPALMVAVIFRMLDALR 262 TTPF+ALL+LA LQM+P D YEAA++DG+HPV+VF+RVTLPLI PALMVAVIFR+LDALR Sbjct: 200 TTPFVALLVLAALQMLPKDCYEAAEVDGIHPVKVFFRVTLPLITPALMVAVIFRLLDALR 259 Query: 263 IFDLIYVLTPNNAQTKTMSVMARENLFDFDKFAYGAAASTMLFLIIATITILYMWLGRLN 322 +FD+IYVLT N+ T +MS+ AR+ L +F YG+AAST+LFLIIA TI Y++LGR Sbjct: 260 VFDVIYVLTSNSTSTMSMSIYARQQLVEFQDVGYGSAASTLLFLIIALATIAYLYLGRKQ 319 Query: 323 LSGG 326 L G Sbjct: 320 LQLG 323 Lambda K H 0.328 0.140 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 452 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 325 Length adjustment: 28 Effective length of query: 300 Effective length of database: 297 Effective search space: 89100 Effective search space used: 89100 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory