Align ABC transporter for Xylitol, permease component 1 (characterized)
to candidate WP_086510094.1 BZY95_RS11665 sugar ABC transporter permease
Query= reanno::Dino:3607126 (288 letters) >NCBI__GCF_002151265.1:WP_086510094.1 Length = 325 Score = 139 bits (349), Expect = 1e-37 Identities = 87/287 (30%), Positives = 147/287 (51%), Gaps = 15/287 (5%) Query: 8 KTVFAFIGPAVIGLALVGIAPLLYALWTSLHFYNLTKLRRVEFIGLENY--------WTV 59 + + F+ P ++ LA+V PLL + S +L+ + FIGLENY + V Sbjct: 31 RAAWLFLAPMLVTLAMVAGWPLLRTFYFSFTDASLSDMSNTLFIGLENYLVYDDGRWFGV 90 Query: 60 LTDEVFWQAMGRTFFLLGTALPLQIALGLGIALVLHQPGLTLVKTLARLSLVLPMATTYA 119 L D ++W+A+ T + ++ L++ G+ +ALVL+ +TL R ++++P A Sbjct: 91 LADPIWWRAVWNTVYFSVVSVSLEVVFGVIVALVLNAEFKG--RTLVRAAVLIPWAIPTI 148 Query: 120 VVGLLGQVMFNQKFGVVNQLLGG-----ADINWIGDPENAFAMIIFWDVWQWTPFVALVL 174 V + M N +FG++N LL + I W D + +I DVW+ TPFVAL++ Sbjct: 149 VSAQMWAWMLNDQFGIINHLLMALGIIASPIAWTADANYSMWAVIMVDVWKTTPFVALLV 208 Query: 175 LAGLTMVPGEVEEAARLETKSKWTVLRYVQLPFLLPGLVAVLILRTADTLKLFDMVFTLT 234 LA L M+P + EAA ++ V V LP + P L+ +I R D L++FD+++ LT Sbjct: 209 LAALQMLPKDCYEAAEVDGIHPVKVFFRVTLPLITPALMVAVIFRLLDALRVFDVIYVLT 268 Query: 235 RGGPGSSTEFISLMIQRVGFRGFDQGLASAQAIILLIITIVLAQIYI 281 + + I Q V F+ G A++ + L+I +A +Y+ Sbjct: 269 SNSTSTMSMSIYARQQLVEFQDVGYGSAASTLLFLIIALATIAYLYL 315 Lambda K H 0.329 0.144 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 325 Length adjustment: 27 Effective length of query: 261 Effective length of database: 298 Effective search space: 77778 Effective search space used: 77778 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory