Align AraV, component of Arabinose, fructose, xylose porter (characterized)
to candidate WP_086510097.1 BZY95_RS11680 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= TCDB::Q97UF2 (371 letters) >NCBI__GCF_002151265.1:WP_086510097.1 Length = 368 Score = 199 bits (505), Expect = 1e-55 Identities = 123/374 (32%), Positives = 200/374 (53%), Gaps = 27/374 (7%) Query: 1 MTTIRVENLSKIFKKGKTEVKAVDNVSITIDSGMAFGVLGPSGHGKTTFLRLIAGLEEPT 60 M ++ ++ ++K+F G T + + +V + I G +GPSG GK+T LRLIAGLE T Sbjct: 1 MASVTLDKINKVF--GSTHI--IKDVDLAIGEGEFVVFVGPSGCGKSTLLRLIAGLESIT 56 Query: 61 SGYIYFDNEAVSSPRRVMMSPEKRGIAMVFQNWALYPNMTVFDNIAFPLKLAKVPKDKIE 120 G + ++ V+ + P +RG+ MVFQ++ALYP+MTV++N+AF LKLAK K+ + Sbjct: 57 DGELSIGDQVVNE-----LPPRERGVGMVFQSYALYPHMTVYENMAFGLKLAKTAKETVH 111 Query: 121 NKVKEVSEELGLSGVLNRYPKELSGGQMQRTAIARALVKDPKVLLLDEPFSNLDAQIRES 180 +V + L L +L R PK LSGGQ QR A+ RA+ ++P++LL DEP SNLDA +R Sbjct: 112 ERVMATARILQLEELLERKPKALSGGQRQRVAMGRAMAREPRILLFDEPLSNLDASLRVQ 171 Query: 181 ARALVRKIQRERKLTTLIVSHDPADIFAIANKAGVIVNGKFAQIGTPTEIYEYPATDLIA 240 R + ++ + T + V+HD + +A+K V+ G+ Q+G+P E+Y+ PAT +A Sbjct: 172 MRNEIARLHKRLGSTMVYVTHDQVEAMTLADKIVVLDGGRVEQVGSPQELYQRPATKFVA 231 Query: 241 RLTGE--INLIQAKIIENNAI--------IANLKVPLNNMELKGQSNIVIGLRPDDLTLS 290 G +N + A+++ +A + L +P + + + +G+RP+ L LS Sbjct: 232 GFIGSPTMNFLPARLLGADATGCRIGATGLTELALPQDASGHAQGAALTLGIRPEHLRLS 291 Query: 291 DTLLDKYIDMGIVKVKLVSYGAGIFKIVVSPITDENIDIIVDAEEPL--ETGIETHLLAK 348 + + + + V Y + + P E + +I E P G L Sbjct: 292 EAQGSEGFE-----IVNVEYLGNEVYVYLEPKEGETL-LIQRGEAPTTWRVGQRVTLAPD 345 Query: 349 PNKVKIFDLNGSNL 362 P V +FD G L Sbjct: 346 PEHVHLFDAGGRAL 359 Lambda K H 0.317 0.136 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 303 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 368 Length adjustment: 30 Effective length of query: 341 Effective length of database: 338 Effective search space: 115258 Effective search space used: 115258 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory