Align MtlK, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized)
to candidate WP_086510097.1 BZY95_RS11680 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= TCDB::O30494 (367 letters) >NCBI__GCF_002151265.1:WP_086510097.1 Length = 368 Score = 363 bits (933), Expect = e-105 Identities = 191/363 (52%), Positives = 255/363 (70%), Gaps = 4/363 (1%) Query: 1 MANLKIKNLQKGFEGFSIIKGIDLEVNDKEFVVFVGPSGCGKSTLLRLIAGLEEVSEGTI 60 MA++ + + K F IIK +DL + + EFVVFVGPSGCGKSTLLRLIAGLE +++G + Sbjct: 1 MASVTLDKINKVFGSTHIIKDVDLAIGEGEFVVFVGPSGCGKSTLLRLIAGLESITDGEL 60 Query: 61 ELDGRDITEVTPAKRDLAMVFQTYALYPHMSVRKNMSFALDLAGVDKQLVESKVNEAARI 120 + + + E+ P +R + MVFQ+YALYPHM+V +NM+F L LA K+ V +V ARI Sbjct: 61 SIGDQVVNELPPRERGVGMVFQSYALYPHMTVYENMAFGLKLAKTAKETVHERVMATARI 120 Query: 121 LELGPLLERKPKQLSGGQRQRVAIGRAIVRNPKIFLFDEPLSNLDAALRVQMRLELARLH 180 L+L LLERKPK LSGGQRQRVA+GRA+ R P+I LFDEPLSNLDA+LRVQMR E+ARLH Sbjct: 121 LQLEELLERKPKALSGGQRQRVAMGRAMAREPRILLFDEPLSNLDASLRVQMRNEIARLH 180 Query: 181 KELQATMIYVTHDQVEAMTLADKVVVLNSGRIEQVGSPLELYHQPANLFVAGFLGTPKMG 240 K L +TM+YVTHDQVEAMTLADK+VVL+ GR+EQVGSP ELY +PA FVAGF+G+P M Sbjct: 181 KRLGSTMVYVTHDQVEAMTLADKIVVLDGGRVEQVGSPQELYQRPATKFVAGFIGSPTMN 240 Query: 241 FLKGKVTRVDGQGCEVQLDAGTLISLPLSGASLSVGSAVTLGIRPEHLEIASPGQTTLTV 300 FL ++ D GC + T ++LP + + G+A+TLGIRPEHL ++ + Sbjct: 241 FLPARLLGADATGCRIGATGLTELALPQDASGHAQGAALTLGIRPEHLRLSEAQGSEGFE 300 Query: 301 TADVGERLGSDTFCHVITSNGEPLTMRIRGDMASQY--GETLHLHLDPAHCHLFDTDGVA 358 +V E LG++ + ++ GE L ++ RG+ + + G+ + L DP H HLFD G A Sbjct: 301 IVNV-EYLGNEVYVYLEPKEGETLLIQ-RGEAPTTWRVGQRVTLAPDPEHVHLFDAGGRA 358 Query: 359 VAV 361 ++V Sbjct: 359 LSV 361 Score = 24.6 bits (52), Expect = 0.004 Identities = 12/28 (42%), Positives = 15/28 (53%) Query: 275 VGSAVTLGIRPEHLEIASPGQTTLTVTA 302 VG VTL PEH+ + G L+V A Sbjct: 336 VGQRVTLAPDPEHVHLFDAGGRALSVKA 363 Lambda K H 0.319 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 400 Number of extensions: 25 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 367 Length of database: 368 Length adjustment: 30 Effective length of query: 337 Effective length of database: 338 Effective search space: 113906 Effective search space used: 113906 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory