Align mannitol dehydrogenase (EC 1.1.1.255) (characterized)
to candidate WP_086510112.1 BZY95_RS11780 alcohol dehydrogenase AdhP
Query= BRENDA::Q38707 (365 letters) >NCBI__GCF_002151265.1:WP_086510112.1 Length = 342 Score = 168 bits (426), Expect = 2e-46 Identities = 106/325 (32%), Positives = 167/325 (51%), Gaps = 15/325 (4%) Query: 36 GEKDVRLKVLFCGVCHSDHHMIHNNWGFTTYP-IVPGHEIVGVVTEVGSKVEKVKVGDNV 94 G +V +K+ GVCH+D H H +W P +PGHE VG V VG+ V+ +K GD + Sbjct: 28 GPGEVLVKIAASGVCHTDLHAAHGDWPVKPNPPFIPGHEGVGHVAAVGAGVKHLKEGDRI 87 Query: 95 GIGCLVGSCRSCESCCDNRESHCENTIDTYGSIYFDGTMTHGGYSDTMVADEHFILRWPK 154 G+ L +C CE C E+ CE+ +T G +GG++D +A + P Sbjct: 88 GVPWLHSACGHCEHCLGGWETLCESQQNT-------GYSVNGGFADYTLAVADYAGHLPD 140 Query: 155 NLPLDSGAPLLCAGITTYSPLKYYGLDKPGTKIGVVGLGGLGHVAVKMAKAFGAQVTVID 214 N+ AP+LCAG+T Y LK +PG + + G+GGLGH+AV+ AKA G V +D Sbjct: 141 NVGFVEVAPVLCAGVTVYKGLKVTD-TRPGQWVVISGIGGLGHMAVQYAKAMGLNVAAVD 199 Query: 215 ISESKRKEALEKLGADSFLLNSDQEQ----MKGARSSLDGIIDTVPVNHPLAPLFDLLKP 270 I ++K A E+LGA S +N+ + +K A G++ T +++ Sbjct: 200 IDDAKLALA-ERLGA-SVTVNAAKTDPVAYLKKAIGGAHGVLVTAVSPKAFEQAQGMVRR 257 Query: 271 NGKLVMVGAPEKPFELPVFSLLKGRKLLGGTINGGIKETQEMLDFAAKHNITADVEVIPM 330 G + + G P F LP+F + + G+I G ++ QE LDFA + + A V + Sbjct: 258 GGTISLNGLPPGDFPLPIFETVLNGITVRGSIVGTRQDLQESLDFAGEGKVKATVSTDRL 317 Query: 331 DYVNTAMERLVKSDVRYRFVIDIAN 355 + +N +RL + + R V+D+A+ Sbjct: 318 ENINDVFQRLHEGRIEGRVVLDLAS 342 Lambda K H 0.319 0.137 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 284 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 342 Length adjustment: 29 Effective length of query: 336 Effective length of database: 313 Effective search space: 105168 Effective search space used: 105168 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory