Align ABC transporter for L-Lysine, permease component 2 (characterized)
to candidate WP_086510333.1 BZY95_RS12915 glutamine ABC transporter permease GlnP
Query= reanno::pseudo5_N2C3_1:AO356_09910 (229 letters) >NCBI__GCF_002151265.1:WP_086510333.1 Length = 218 Score = 130 bits (326), Expect = 3e-35 Identities = 72/222 (32%), Positives = 125/222 (56%), Gaps = 8/222 (3%) Query: 2 NWDVIIKWLPKLAQGATLTLELVAIAVIAGLLLAIPLGIARSSRLWQVRALPYAYIFFFR 61 +W VI+ ++P+L +GA +T+ + + + G+++ GI R+ W + YI R Sbjct: 4 DWSVIVTFMPQLLKGAQMTIFITVVGLCGGMVVGAIAGIMRAYGNWLLNYTAMVYIEVIR 63 Query: 62 GTPLLVQLFLVYYGLAQFDAVRSSALWPYLRDPFWCATVTMTLHTAAYIAEILRGAIQAI 121 GTP++VQ+ +Y+ L ++R DP A + + ++ AYIAEI+RG++Q+I Sbjct: 64 GTPIVVQVMFLYFALPVLASIRI--------DPLSAAMIAIVINAGAYIAEIVRGSLQSI 115 Query: 122 PKGEIEAARALGMSRPKALFYIMLPRAARIGLPAYSNEVILMLKASALASTVTLLELTGM 181 +G EA ALG+ R K L YI+ P A R +P N+ I+ LK ++L + + ELT Sbjct: 116 SRGLAEAGLALGLPRWKVLLYIVGPLAFRRLIPPLGNQFIISLKDTSLFIVIGVGELTRT 175 Query: 182 ARTIIARTYLPVEIFFAAGMFYLLMSFLLVQGFKQLERWLRV 223 + I+A + VEI+ A + YL+M+ L + +ER +++ Sbjct: 176 GQEIMAANFRAVEIWSAIAIMYLIMTGSLTLMLRFIERRMKI 217 Lambda K H 0.331 0.141 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 129 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 229 Length of database: 218 Length adjustment: 22 Effective length of query: 207 Effective length of database: 196 Effective search space: 40572 Effective search space used: 40572 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory