Align L-Arginine ABC transporter, permease protein AotM (characterized)
to candidate WP_086510333.1 BZY95_RS12915 glutamine ABC transporter permease GlnP
Query= reanno::pseudo6_N2E2:Pf6N2E2_5662 (232 letters) >NCBI__GCF_002151265.1:WP_086510333.1 Length = 218 Score = 117 bits (293), Expect = 2e-31 Identities = 70/219 (31%), Positives = 114/219 (52%), Gaps = 8/219 (3%) Query: 4 DYNVIYEALPLYFSGLLTTLKLLALSLFFGLLAALPLGLMRVSKQPIVNMTAWLYTYVIR 63 D++VI +P G T+ + + L G++ G+MR ++N TA +Y VIR Sbjct: 4 DWSVIVTFMPQLLKGAQMTIFITVVGLCGGMVVGAIAGIMRAYGNWLLNYTAMVYIEVIR 63 Query: 64 GTPMLVQLFLIYYGLAQFAIVRESFLWPWLSSATFCACLAFAINTSAYTAEIIAGSLRAT 123 GTP++VQ+ +Y+ L A +R L A +A IN AY AEI+ GSL++ Sbjct: 64 GTPIVVQVMFLYFALPVLASIRIDPL--------SAAMIAIVINAGAYIAEIVRGSLQSI 115 Query: 124 SNGEIEAAKAMGMSRYKLYRRILLPSALRRALPQYSNEVIMMLQTTSLASIVTLIDITGA 183 S G EA A+G+ R+K+ I+ P A RR +P N+ I+ L+ TSL ++ + ++T Sbjct: 116 SRGLAEAGLALGLPRWKVLLYIVGPLAFRRLIPPLGNQFIISLKDTSLFIVIGVGELTRT 175 Query: 184 ARTVNAQYYLPFEAYITAGVFYLCLTFILVRLFKLAERR 222 + + A + E + + YL +T L + + ERR Sbjct: 176 GQEIMAANFRAVEIWSAIAIMYLIMTGSLTLMLRFIERR 214 Lambda K H 0.330 0.140 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 110 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 232 Length of database: 218 Length adjustment: 22 Effective length of query: 210 Effective length of database: 196 Effective search space: 41160 Effective search space used: 41160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory