Align Putative TRAP dicarboxylate transporter, DctM subunit (characterized, see rationale)
to candidate WP_086510676.1 BZY95_RS14790 TRAP transporter large permease
Query= uniprot:Q88NP0 (426 letters) >NCBI__GCF_002151265.1:WP_086510676.1 Length = 426 Score = 400 bits (1029), Expect = e-116 Identities = 199/421 (47%), Positives = 290/421 (68%), Gaps = 2/421 (0%) Query: 5 ILLGSFIVLILIGMPVAYALGLSALIGAWWIDIPLQAMMIQVASGVNKFSLLAIPFFVLA 64 IL G F ++ G PVA+A+GL+A+ + +PL ++ SG++ FSLLAIPFF+ A Sbjct: 5 ILFGVFFFGLVAGAPVAFAVGLAAVATFLYEGLPLFVAFQRILSGISVFSLLAIPFFIFA 64 Query: 65 GAIMAEGGMSRRLVAFAGVLVGFVRGGLSLVNIMASTFFGAISGSSVADTASVGSVLIPE 124 G +M GG+S RLV A VG +RGGL +VN+ +S FG ISGS+VADT+++GS+L+P Sbjct: 65 GELMLHGGISARLVRLASAAVGRMRGGLGIVNVSSSMLFGGISGSAVADTSALGSILVPV 124 Query: 125 MERKGYPREFSTAVTVSGSVQALLTPPSHNSVLYSLAAGGTVSIASLFMAGIMPGLLLSA 184 M+ KGY +++ VTV+ SV ++ PPSHN +LY++AAGG +S+ LF+AGI+PG+L+ Sbjct: 125 MKEKGYDADYAVNVTVTSSVAGVVIPPSHNMILYAVAAGGGISVTQLFIAGIVPGILMCL 184 Query: 185 VMMGLCLIFAKKRNYPKGEVIPLREALKIA-GEALWGLMAMVIILGGILSGVFTATESAA 243 + + A KR Y +GE P + L I+ AL GL+ VII+GG+LSG+ T TES A Sbjct: 185 TLAVAAYLVAVKRGY-QGETFPGWDVLIISLAAALPGLLTAVIIVGGVLSGILTVTESGA 243 Query: 244 VAVVWSFFVTMFIYRDYKWRDLPKLMHRTVRTISIVMILIGFAASFGYVMTLMQIPSKIT 303 +++ VT +YR+ +W + ++V+T ++VMIL+G A++F Y++ L +P +T Sbjct: 244 FGAIYAVVVTALVYRELRWASFKAAVLQSVKTTALVMILVGCASAFSYLLALYNVPLLLT 303 Query: 304 TAFLTLSDNRYVILMCINFMLMLLGTVMDMAPLILILTPILLPVITGIGVDPVHFGMIML 363 + LSD +I + +N +L++LG +MDMA LILI TPI LPV G+DP+ FG+IM+ Sbjct: 304 DVLMGLSDKPIIIFLLLNLLLLVLGMIMDMAALILICTPIFLPVAMQFGMDPIQFGIIMM 363 Query: 364 VNLGIGLITPPVGAVLFVGSAIGKVSIESTVKALMPFYLALFLVLMAVTYIPAISLWLPS 423 +NLG+GL TPPVGA LFVG IGK+ IE V+ + PFYLALF+ LM VTY+PA+SL LP+ Sbjct: 364 MNLGLGLCTPPVGACLFVGCVIGKIKIEEAVRTIWPFYLALFVALMLVTYVPAVSLSLPA 423 Query: 424 V 424 + Sbjct: 424 L 424 Lambda K H 0.329 0.142 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 596 Number of extensions: 40 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 426 Length adjustment: 32 Effective length of query: 394 Effective length of database: 394 Effective search space: 155236 Effective search space used: 155236 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory