Align 2-oxoisovalerate dehydrogenase subunit beta; Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; BCKDH E1-beta; EC 1.2.4.4 (characterized)
to candidate WP_086510719.1 BZY95_RS15035 thiamine pyrophosphate-dependent enzyme
Query= SwissProt::Q5SLR3 (324 letters) >NCBI__GCF_002151265.1:WP_086510719.1 Length = 742 Score = 166 bits (421), Expect = 1e-45 Identities = 108/290 (37%), Positives = 160/290 (55%), Gaps = 16/290 (5%) Query: 6 MVQALNRALDEEMAKDPRVVVLGEDVGKRGGVFLVTEGLLQKYGPDRVMDTPLSEAAIVG 65 M + LN++L M + P +V+ GED+G++GGV+ VT+ L ++GP RV+DT L E +I+G Sbjct: 388 MAKLLNQSLARLMERYPHLVMAGEDIGRKGGVYGVTQRLQAQFGPHRVIDTLLDEQSILG 447 Query: 66 AALGMAAHGLRPVAEIQFADYIFPGFDQLVSQVAKLRYRSGGQFTAPLVVRMPSGGGVR- 124 +G+ +GL P+ EIQF Y+ DQL + A L + S GQ+T P+VVR+ G + Sbjct: 448 LGIGLGQNGLVPILEIQFLAYLHNAEDQLRGEAATLSFFSNGQYTNPMVVRIAGLGYQKG 507 Query: 125 -GGHHHSQSPEAHFVHTAGLKVVAVSTPYDAKGLLKAAIR--DEDP--VVFLEPKRLY-- 177 GGH H+ + A GL V S DA GLL+ A+R DE+ VV +EP LY Sbjct: 508 FGGHFHNDNAIAVLRDIPGLLVACPSNAADAVGLLQEAVRLADEEQRVVVVIEPIALYHT 567 Query: 178 RSVKEE--------VPEEDYTLPIGKAALRREGKDLTLIGYGTVMPEVLQAAAELAKAGV 229 R + EE P ++ L G EG++L ++ YG + QAAA L GV Sbjct: 568 RDLHEEGDQQWCFADPGPEHRLAQGALGQWGEGRELAIVTYGNGVYLSRQAAARLEAQGV 627 Query: 230 SAEVLDLRTLMPWDYEAVMNSVAKTGRVVLVSDAPRHASFVSEVAATIAE 279 ++DLR L D++AV VA+ G+V++V + R S E+ + E Sbjct: 628 HLRIVDLRWLTAIDHDAVHRRVAECGQVLIVDECRRSGSLSEELITALVE 677 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 496 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 742 Length adjustment: 34 Effective length of query: 290 Effective length of database: 708 Effective search space: 205320 Effective search space used: 205320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory