Align Inner membrane ABC transporter permease protein (characterized, see rationale)
to candidate WP_086510782.1 BZY95_RS15415 sugar ABC transporter permease
Query= uniprot:A8LLL5 (334 letters) >NCBI__GCF_002151265.1:WP_086510782.1 Length = 310 Score = 120 bits (302), Expect = 3e-32 Identities = 91/309 (29%), Positives = 159/309 (51%), Gaps = 17/309 (5%) Query: 36 AKGPKAGRNINRANQ--IRPWI---FLFPALFVLLLYLGYPVVETLRLSLLERVPGGGYQ 90 A P AG R++ ++ W+ L P+ + L ++ ++ T LSL Y+ Sbjct: 7 AARPTAGSTARRSHSGLLQAWLPKLVLAPSAAISLFFVYGFMLWTFVLSLTNSRMLPSYE 66 Query: 91 WVGLDNYAQMASEPKFWEAMRNNMFWLIVVPALSTAFGLLAAQLTD-RIKWGNVAKSIIF 149 +VG YA++ + ++W A N + + + A+ A GL+ A L D RI+ ++I Sbjct: 67 FVGFAQYARLMANDRWWVASTNLVVFGGLFVAICLALGLVLAILLDQRIRQEGALRTIYL 126 Query: 150 MPMAISFVGASVIWKLVYDGRPIEQEQIGILNAIIVGLGGDPVTF--LTIPFWNNFFLMI 207 PMA+SF+ V+WK + + +GI A++ G + F L P + L+I Sbjct: 127 YPMALSFIVTGVVWKWLLN------PGLGI-QAMVRSWGFENFRFDWLVDPDMAVYTLVI 179 Query: 208 VLVWVQTGFAMVILSAALRGIPEETIEAAIIDGASPLQIFFKIKVPQIMPTVVVVWTTIT 267 VW +GF M + A LRGI + ++AA +DGAS +I++++ +P + P V ++ Sbjct: 180 AAVWQASGFVMALFLAGLRGIDDSILKAAQLDGASLPRIYWRVVIPCLRPVVFSAVMILS 239 Query: 268 LVVLKVFDIVFAMTNG--QWETQVLANYMFDKLFRANDWGVGSASAMVIMLLVTPILIWN 325 + +K FD+V A+T G + + + A +M+ F G+GSASAM+++ V ILI Sbjct: 240 HIAIKSFDLVVALTGGGPGYASDLPATFMYAHAFTRAQIGLGSASAMLMLGGVLAILIPY 299 Query: 326 IHSARKEMR 334 ++S + R Sbjct: 300 LYSELRSRR 308 Lambda K H 0.329 0.143 0.455 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 265 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 334 Length of database: 310 Length adjustment: 28 Effective length of query: 306 Effective length of database: 282 Effective search space: 86292 Effective search space used: 86292 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory